where exactly is Firefly Wellness?
Question · by reader_ray · Member since Jul 2026 · 24 posts · 4w4 weeks ago
Firefly Wellness Day Spa
UnclaimedDay spa in San Diego, CA
4.9 · 170 reviewsOpen today until 8 PMOpen until 8
Firefly Spa is a boutique neighborhood spa in Mission Hills, San Diego. Offering customized massage, acupuncture, facials, waxing and lash extensions. Signature services include deep tissue massage, prenatal massage, couples massage and Swedish massage, with enhancements like hot stones, cupping, and CBD oil. Our estheticians provide relaxing, results-driven facials featuring dermaplaning, LED red light therapy, and collagen masks to leave your skin glowing. Locals from Mission Hills, Little Italy, Hillcrest, Old Town, Bankers Hill, North Park, University Heights and Downtown San Diego choose Firefly Spa for consistent, high-quality self-care. Whether you're booking a monthly facial or weekly massage, your wellness journey starts here!
Eligible to offer 20% cashback to customers who shop here.OrbitBack
Add your name so AI can say who owns the business
Unclaimed · Replies to reviews · Add the year you opened so AI can say how long you've been open
ConfirmedVisitor submittedAI guess
Updated Oct 9, 2026Last activity 27 days ago, a question from second_opinion_blowouts.
Locals
13 asked · 0 answered by Firefly Wellness
does Firefly Wellness ever have cancellations
Question · by second_opinion_blowouts · Member since Sep 2026 · 5 posts · 3w3 weeks ago
what has this salon posted recently, I am not on Instagram
Question · by mirrors_zadie · Member since Aug 2026 · 2 posts · 4w4 weeks ago
Are the hours on Google right for Firefly Wellness in San Diego?
Question · by weekend_only_owl · Member since Jul 2026 · 35 posts · 4w4 weeks ago
how far out is this salon booking right now?
Question · by no_rush_roots · Member since Aug 2026 · 6 posts · 5w5 weeks ago
Anything this salon is known for doing well?
Question · by first_timer_on_ibis · Member since Oct 2026 · 1 post · 4w4 weeks ago
Calling Firefly Wellness, or is there a better way?
Question · by roots_reed · Member since Aug 2026 · 13 posts · 4w4 weeks ago
is there a way to spread the cost here
Question · by trims_fern · Member since Sep 2026 · 2 posts · 5w5 weeks ago
Street parking near here, any good?
Question · by march_may_92103 · Member since Sep 2026 · 1 post · 5w5 weeks ago
torn between Firefly Wellness and Karma Wellness?
Question · by aprons_clover · Member since Sep 2026 · 5 posts · 6w6 weeks ago
booked my first appointment here, how does it go
Question · by new_here_fern · Member since Jul 2026 · 29 posts · 8w8 weeks ago
anyone at Firefly Wellness people keep going back to?
Question · by second_opinion_polish · Member since Sep 2026 · 1 post · 6w6 weeks ago
trying to avoid the rush, which day is quiet
Question · by aprons_roan · Member since Sep 2026 · 2 posts · 7w7 weeks ago
Services
What Firefly Wellness offers, what it costs, and what people come for.
Known for
- Facials40% of reviews
The menu
Firefly Wellness lists 31 services. These are the 13 people ask about most, with how many reviews mention each.
ServiceCategoryDescription
FacialsFrom their website
Day spa
Facials are skin treatments designed to cleanse, exfoliate, and hydrate the skin. Our skilled estheticians customize each facial to address individual skin types and concerns, ensuring a refreshing experience that leaves your skin glowing.
ConfirmationFrom their website
Day spa
Confirmation is a service that ensures your appointment details are accurately communicated. We provide timely reminders to help you prepare for your visit and make the most of your experience with us.
Womens history monthFrom their website
Day spa
Women’s History Month is celebrated with special offerings that honor the contributions of women. We highlight unique treatments and services that reflect empowerment and self-care for women throughout March.
Brazilian waxFrom their website
Day spa
Brazilian wax is a hair removal service that removes hair from the bikini area for a smooth finish. Our trained estheticians ensure a comfortable experience while providing expert care and attention to detail.
Cancellation policyFrom their website
Day spa
Our cancellation policy outlines the guidelines for rescheduling or canceling appointments. We aim to accommodate our clients while ensuring that our schedule remains efficient and fair.
Firefly focus may editionFrom their website
Day spa
The Firefly Focus May Edition features exclusive treatments and promotions tailored for the month. We highlight seasonal services that enhance wellness and relaxation during this time of year.
Celluma LED light therapyFrom their website
Day spa
Celluma LED light therapy is a non-invasive treatment that uses light energy to promote skin health. Our trained staff customizes each session to target specific skin concerns, providing a soothing experience that enhances overall skin appearance.
Acne awareness monthFrom their website
Day spa
Acne Awareness Month is recognized with special educational initiatives and tailored treatments. We provide insights and services aimed at helping individuals manage and understand acne.
Spring awakeningFrom their website
Day spa
Covid 19 safety measuresFrom their website
Day spa
Our Covid 19 safety measures include enhanced cleaning protocols and social distancing practices to ensure a safe environment for all guests. We prioritize your health and well-being while providing a serene spa experience.
Mens facialsFrom their website
Day spa
Men’s facials are specifically designed to address the unique skincare needs of male clients. Our estheticians provide tailored treatments that cleanse and rejuvenate the skin.
MicroneedlingFrom their website
Day spa
AcupunctureFrom their website
Day spa
Acupuncture is a holistic treatment that involves inserting thin needles into specific points on the body. Our licensed acupuncturist provides personalized sessions to promote relaxation and balance.
See all 31 services
Firefly linksFrom their website
Day spa
Firefly Links is a resource that connects clients to wellness information and community events. We aim to foster a sense of connection and support among our clients.
Hot stone massageFrom their website
Day spa
Hot stone massage involves the use of heated stones placed on specific points of the body to promote relaxation and relieve tension. This technique is performed by our skilled therapists, providing a deeply calming experience.
Firefly focus april editionFrom their website
Day spa
The Firefly Focus April Edition showcases special treatments and promotions for the month. We highlight seasonal services that encourage relaxation and rejuvenation.
Microneedling frequently asked questions answeredFrom their website
Day spa
National sunscreen dayFrom their website
Day spa
National Sunscreen Day is recognized with educational initiatives and special promotions. We emphasize the importance of sun protection and offer products to help clients care for their skin.
October firefly focusFrom their website
Day spa
The October Firefly Focus features seasonal treatments and promotions tailored for fall. We highlight services that promote wellness and relaxation during this time of year.
Peels proseccoFrom their website
Day spa
Peels Prosecco is a special treatment that combines exfoliating peels with a celebratory touch. This service aims to refresh the skin while providing a unique experience.
Prenatal massageFrom their website
Day spa
Prenatal massage is a specialized service designed for expectant mothers. Our trained therapists provide gentle techniques to promote relaxation and comfort during pregnancy.
September firefly focusFrom their website
Day spa
The September Firefly Focus highlights exclusive treatments and promotions for the month. We feature services that encourage self-care as summer transitions into fall.
Spring skincareFrom their website
Day spa
Swedish massage
Day spa
Swedish massage is a relaxing technique that uses long strokes, kneading, and gentle movements to promote overall relaxation. Our trained therapists deliver this service in a serene environment, enhancing your comfort and tranquility.
Valentines weekend couples massageFrom their website
Day spa
Valentines weekend couples massage is a shared experience designed for partners to relax together. This service includes synchronized massages in a serene setting, creating a perfect retreat for couples.
Collagen facialFrom their website
Day spa
Collagen facial is a treatment that aims to boost skin elasticity and hydration. Our estheticians customize this service to meet individual skin needs, ensuring a revitalizing experience.
Firefly focus august editionFrom their website
Day spa
The Firefly Focus August Edition features special treatments and promotions for the month. We highlight services that promote relaxation and self-care during the summer.
Firefly focus february editionFrom their website
Day spa
The Firefly Focus February Edition showcases exclusive treatments and promotions for the month. We highlight services that encourage wellness and relaxation during this time.
Firefly focus july editionFrom their website
Day spa
The Firefly Focus July Edition features seasonal treatments and promotions tailored for summer. We highlight services that enhance relaxation and rejuvenation during this time.
Firefly focus march editionFrom their website
Day spa
The Firefly Focus March Edition showcases special treatments and promotions for the month. We highlight services that encourage self-care and relaxation during this time.
CBD oil
Day spa
CBD oil is available as an add-on to various treatments for its soothing properties. Our trained staff can incorporate CBD oil into massages or facials for enhanced relaxation.
- FacialsFrom their websiteDay spa
- ConfirmationFrom their websiteDay spa
- Womens history monthFrom their websiteDay spa
- Brazilian waxFrom their websiteDay spa
- Cancellation policyFrom their websiteDay spa
- Firefly focus may editionFrom their websiteDay spa
- Celluma LED light therapyFrom their websiteDay spa
- Acne awareness monthFrom their websiteDay spa
- Spring awakeningFrom their websiteDay spa
- Covid 19 safety measuresFrom their websiteDay spa
- Mens facialsFrom their websiteDay spa
- MicroneedlingFrom their websiteDay spa
- AcupunctureFrom their websiteDay spa
- Firefly linksFrom their websiteDay spa
- Hot stone massageFrom their websiteDay spa
- Firefly focus april editionFrom their websiteDay spa
- Microneedling frequently asked questions answeredFrom their websiteDay spa
- National sunscreen dayFrom their websiteDay spa
- October firefly focusFrom their websiteDay spa
- Peels proseccoFrom their websiteDay spa
- Prenatal massageFrom their websiteDay spa
- September firefly focusFrom their websiteDay spa
- Spring skincareFrom their websiteDay spa
- Swedish massageDay spa
- Valentines weekend couples massageFrom their websiteDay spa
- Collagen facialFrom their websiteDay spa
- Firefly focus august editionFrom their websiteDay spa
- Firefly focus february editionFrom their websiteDay spa
- Firefly focus july editionFrom their websiteDay spa
- Firefly focus march editionFrom their websiteDay spa
- CBD oilDay spa
Photos
Add media AI can read
No code detected[Photo 1]
No code detected[Photo 2]
No code detected[Photo 3]
No code detected[Photo 4]Team
Who you'll see, and whether their licenses check out.Visit
When it's quiet, where to park, and what's nearby.
Best place to park
Add your parking so AI can tell people where to parkGetting in
Add how to find your door so AI can walk people inAddress4024 Ibis St Ste a, San Diego, CA 92103, USA
Phone(619) 693-8568
Websitefireflywellnessdayspa.com
Mon to Sat10 AM to 8 PM
Sun11 AM to 5 PM
Around San Diego
Meshuggah Shack is a 3 minute walk for coffee. Fort Oak is a 2 minute walk for an American restaurant.
- 1Fort OakAmerican restaurant · a 2 minute walk
- 2What De Health ThaiThai restaurant · a 2 minute walk
- 3Izakaya MasaIzakaya restaurant · a 3 minute walk
- 4La PuertaMexican restaurant · a 3 minute walk
- 5Lefty's Chicago PizzeriaPizza restaurant · a 3 minute walk
- 6Meshuggah ShackCafe · a 3 minute walk
Nearby places from Google Maps, read Oct 25, 2026.
All the details
Every row is something the owner can add or correct. Each one is marked Confirmed, Visitor submitted or AI guess, with where it came from.
Listing
NameFirefly Wellness Day Spa
Primary categoryDay Spa
Other categoryAdd this so AI can answer it
Opening dateAdd this so AI can answer it
Contact
Phone(619) 693-8568
Websitefireflywellnessdayspa.com
Menu linkAdd this so AI can answer it
Booking linkAdd this so AI can answer it
MessagingAdd this so AI can answer it
Location
Address4024 Ibis St Ste a, San Diego, CA 92103, USA
Plus codeAdd this so AI can answer it
Located inAdd this so AI can answer it
Service areaAdd this so AI can answer it
Hours
Monday10 AM to 8 PM
Tuesday10 AM to 8 PM
Wednesday10 AM to 8 PM
Thursday10 AM to 8 PM
Friday10 AM to 8 PM
Saturday10 AM to 8 PM
Sunday11 AM to 5 PM
Special hoursAdd this so AI can answer it
Holiday hoursAdd this so AI can answer it
Accessibility
Wheelchair-accessible entranceAdd this so AI can answer it
Wheelchair-accessible parkingAdd this so AI can answer it
Wheelchair-accessible restroomAdd this so AI can answer it
Wheelchair-accessible seatingAdd this so AI can answer it
Assistive hearing loopAdd this so AI can answer it
Payments
MastercardAdd this so AI can answer it
American ExpressAdd this so AI can answer it
DiscoverAdd this so AI can answer it
Debit cardsAdd this so AI can answer it
Apple PayAdd this so AI can answer it
Google PayAdd this so AI can answer it
FinancingAdd this so AI can answer it
HSA or FSA cardsAdd this so AI can answer it
Service options
Appointment requiredAdd this so AI can answer it
Walk-insAdd this so AI can answer it
Onsite servicesAdd this so AI can answer it
Online appointmentsAdd this so AI can answer it
Online estimatesAdd this so AI can answer it
Amenities
RestroomAdd this so AI can answer it
ParkingAdd this so AI can answer it
Gender-neutral restroomAdd this so AI can answer it
Language assistanceAdd this so AI can answer it
The business
Legal business nameAdd this so AI can answer it
FoundedAdd this so AI can answer it
Ownership typeAdd this so AI can answer it
LocationsAdd this so AI can answer it
Parent companyAdd this so AI can answer it
Previous namesAdd this so AI can answer it
TaglineAdd this so AI can answer it
Team
Total staffAdd this so AI can answer it
Full-time staffAdd this so AI can answer it
Front deskAdd this so AI can answer it
Language spokenAdd this so AI can answer it
Licenses and credentials
Board certificationAdd this so AI can answer it
City business licenseAdd this so AI can answer it
Liability insuranceAdd this so AI can answer it
License lookup linkAdd this so AI can answer it
Prices
Price rangeAdd this so AI can answer it
ConsultationAdd this so AI can answer it
Deposit to bookAdd this so AI can answer it
Package pricingAdd this so AI can answer it
Membership planAdd this so AI can answer it
First-visit offerAdd this so AI can answer it
Booking and policies
Online booking linkAdd this so AI can answer it
Book by phoneAdd this so AI can answer it
CancellationAdd this so AI can answer it
Late cancel or no-show feeAdd this so AI can answer it
Late arrivalAdd this so AI can answer it
Minimum ageAdd this so AI can answer it
RefundsAdd this so AI can answer it
Children in the waiting roomAdd this so AI can answer it
Offers and programs
Gift cardsAdd this so AI can answer it
Loyalty programAdd this so AI can answer it
Referral programAdd this so AI can answer it
Financing partnerAdd this so AI can answer it
Military or teacher discountAdd this so AI can answer it
Customers
Customers served a yearAdd this so AI can answer it
Repeat customer rateAdd this so AI can answer it
Average spend per visitAdd this so AI can answer it
Most popular first visitAdd this so AI can answer it
Customer satisfaction scoreAdd this so AI can answer it
Busiest monthAdd this so AI can answer it
Community and charity
CharityAdd this so AI can answer it
Donated last yearAdd this so AI can answer it
Volunteer hours a yearAdd this so AI can answer it
Local sponsorshipAdd this so AI can answer it
Free or reduced-cost servicesAdd this so AI can answer it
Recognition and memberships
Professional associationAdd this so AI can answer it
Chamber of commerceAdd this so AI can answer it
BBB profileAdd this so AI can answer it
Press linkAdd this so AI can answer it
Speaking or teachingAdd this so AI can answer it
Brands and products
Links
Websitefireflywellnessdayspa.com
Instagraminstagram.com/fireflyspasd
TikToktiktok.com/@fireflyspasd
Facebookfacebook.com/fireflywellness
YouTubeAdd this so AI can answer it
LinkedInAdd this so AI can answer it
Google reviewsAdd this so AI can answer it
Privacy policyAdd this so AI can answer it
Careers pageAdd this so AI can answer it
Newsletter signupAdd this so AI can answer it
Story and values
MissionAdd this so AI can answer it
Founder storyAdd this so AI can answer it
What makes it differentAdd this so AI can answer it
Eco practiceAdd this so AI can answer it
Local supplierAdd this so AI can answer it
Growth
New service this yearAdd this so AI can answer it
Open jobAdd this so AI can answer it
New location plannedAdd this so AI can answer it
Year-over-year growthAdd this so AI can answer it
Reputation
What reviews, press and directories say about Firefly Wellness.
Reviews
Add reviews AI can read4.9from 170 reviews on Google
Firefly Wellness Day Spa is distinguished by its personalized treatment plans and a wide variety of wellness services. Firefly Wellness Day Spa offers a serene escape with a focus on personalized care. Reviewers describe feeling relaxed and rejuvenated after treatments like deep tissue massages and hydrating facials. The calming atmosphere, complemented by pleasant scents from local artisan candles, enhances the overall experience.
- 5100%
- 40%
- 30%
- 20%
- 10%
Would go back100%100% of reviews give the visit 4 or 5 stars.Positive 100%, 4 or 5 stars · Neutral 0%, 3 stars · Negative 0%, 1 or 2 stars · 1 review says it outright, like "we will be back"
The good
- Deep tissue massages
- Hydrating facials
- Personalized treatment plans
- Clean and calming environment
- Exceptional customer service
The bad
- Uncomfortable pressure during massages
- Noise from outside during treatments
- Restrictions on new clients for certain services
Press and awards
Add press AI can readDirectories
Add to directories AI readsUpdates
Post an updateHow AI sees Firefly Wellness
The AI Score is out of 100, read from 8 signals across search and AI.
32out of 100
26 San Diego avg
What the score is made of
Signal and how much it countsFirefly Wellness
- Retrieval grounding 26%Whether you appear in the ranked results AI retrieves and cites: AI-Overview citations, organic top-10 for your money queries, and the Bing index ChatGPT leans on.18
- Off-property attestation 20%Volume and consistency of what others say about you: YouTube mentions, branded web mentions, third-party “best-of” lists. The cause of retrievability.42
- AI visibility 14%Whether ChatGPT, Gemini, Perplexity, and AI Overviews name you, and whether they name you for the right service.0
- Reviews & response 12%The star average is only one input. We also read volume, velocity, the specificity of review language, and response cadence. Specific reviews are what AI quotes verbatim.94
- Backlink & citation authority 8%Domain authority and editorial quality of the sources that attest to you.56
- Google Business Profile 8%Required and recommended fields; update cadence. The listing AI pulls from first.90
- Speed & mobile 7%Core Web Vitals at the 75th percentile, on a real phone.30
- Content freshness & schema 5%Crawl recency, intent alignment, valid JSON-LD, canonicals.83
Every business is scored the same way, and nobody can pay for a better score.
See exactly what AI says about you, and how to get picked
Firefly Wellness, as AI sees it. Blue signals help Firefly Wellness, and red ones hold it back.
- The questions people ask Gemini and ChatGPT about day spas in San Diego, and who they name instead of you
- What AI gets wrong about you, next to what’s true
- What to change first so AI names you
Claiming your page is free.
What AI reads
The page ChatGPT, Gemini, Perplexity and Google read about Firefly Wellness. The code version is exactly what their crawlers get.
Local AI Registry · Day spas in San Diego, CA · Editorial
Firefly Wellness Day Spa, San Diego CA: Facials Reviews
By Steve Lee, founder and CEO of Local AI Registry. Updated October 9, 2026.
Published October 9, 2026 · Updated October 9, 2026 · Machine-readable version below
In short
Firefly Wellness Day Spa is a day spa in San Diego, CA. Its AI Score is 32 of 100, which is poor.
What each mark on this page means: https://localairegistry.com/methodology#marks
Key facts
| Fact | Value |
|---|---|
| Type | Day spa |
| Address | 4024 Ibis St Ste a, San Diego, CA 92103, USA |
| Hours | Mon to Sat 10 AM to 8 PM · Sun 11 AM to 5 PM |
| Phone | (619) 693-8568 |
| Rating | 4.9 across 170 reviews on Google |
| Known for | Facials |
| Updated | October 9, 2026 |
All the details
Every row is something the owner can add or correct. Each one is marked Confirmed, Visitor submitted or AI guess, with where it came from.
| Group | Fact | Value | Mark | Evidence |
|---|---|---|---|---|
| Location info | Address | 4024 Ibis St Ste a, San Diego, CA 92103, USA | Confirmed | Google Business Profile |
| Location info | Description | Firefly Spa is a boutique neighborhood spa in Mission Hills, San Diego. Offering customized massage, acupuncture, facials, waxing and lash extensions. Signature services include deep tissue massage, prenatal massage, couples massage and Swedish massage, with enhancements like hot stones, cupping, and CBD oil. Our estheticians provide relaxing, results-driven facials featuring dermaplaning, LED red light therapy, and collagen masks to leave your skin glowing. Locals from Mission Hills, Little Italy, Hillcrest, Old Town, Bankers Hill, North Park, University Heights and Downtown San Diego choose Firefly Spa for consistent, high-quality self-care. Whether you're booking a monthly facial or weekly massage, your wellness journey starts here! | Confirmed | Google Business Profile |
| Location info | Hours | Mon to Sat 10:00 AM to 8:00 PM · Sun 11:00 AM to 5:00 PM | Confirmed | Google Business Profile |
| Location info | Name | Firefly Wellness Day Spa | Confirmed | Google Business Profile |
| Location info | Phone | (619) 693-8568 | Confirmed | Google Business Profile |
| Hours | Monday | 10:00 AM to 8:00 PM | Confirmed | Google Business Profile |
| Hours | Tuesday | 10:00 AM to 8:00 PM | Confirmed | Google Business Profile |
| Hours | Wednesday | 10:00 AM to 8:00 PM | Confirmed | Google Business Profile |
| Hours | Thursday | 10:00 AM to 8:00 PM | Confirmed | Google Business Profile |
| Hours | Friday | 10:00 AM to 8:00 PM | Confirmed | Google Business Profile |
| Hours | Saturday | 10:00 AM to 8:00 PM | Confirmed | Google Business Profile |
| Hours | Sunday | 11:00 AM to 5:00 PM | Confirmed | Google Business Profile |
| Services | Service | Acne awareness month | From their website | Business website |
| Services | Service | Acupuncture | From their website | Business website |
| Services | Service | Brazilian wax | From their website | Business website |
| Services | Service | Cancellation policy | From their website | Business website |
| Services | Service | CBD oil | Confirmed | Google Business Profile |
| Services | Service | Celluma led light therapy | From their website | Business website |
| Services | Service | Collagen facial | From their website | Business website |
| Services | Service | Confirmation | From their website | Business website |
| Services | Service | Couples massage | AI guess | |
| Services | Service | Covid 19 safety measures | From their website | Business website |
| Services | Service | Customized massage | AI guess | |
| Services | Service | Deep tissue massage | AI guess | |
| Services | Service | Dermaplaning | AI guess | |
| Services | Service | Facials | From their website | Business website |
| Services | Service | Firefly focus april edition | From their website | Business website |
| Services | Service | Firefly focus august edition | From their website | Business website |
| Services | Service | Firefly focus february edition | From their website | Business website |
| Services | Service | Firefly focus july edition | From their website | Business website |
| Services | Service | Firefly focus march edition | From their website | Business website |
| Services | Service | Firefly focus may edition | From their website | Business website |
| Services | Service | Firefly links | From their website | Business website |
| Services | Service | Hot stone massage | From their website | Business website |
| Services | Service | Lash extensions | AI guess | |
| Services | Service | LED red light therapy | AI guess | |
| Services | Service | Mens facials | From their website | Business website |
| Services | Service | Microneedling | From their website | Business website |
| Services | Service | Microneedling frequently asked questions answered | From their website | Business website |
| Services | Service | National sunscreen day | From their website | Business website |
| Services | Service | October firefly focus | From their website | Business website |
| Services | Service | Peels prosecco | From their website | Business website |
| Services | Service | Prenatal massage | From their website | Business website |
| Services | Service | September firefly focus | From their website | Business website |
| Services | Service | Spring awakening | From their website | Business website |
| Services | Service | Spring skincare | From their website | Business website |
| Services | Service | Swedish massage | Confirmed | Google Business Profile |
| Services | Service | Valentines weekend couples massage | From their website | Business website |
| Services | Service | Waxing | AI guess | |
| Services | Service | Womens history month | From their website | Business website |
| Links | https://facebook.com/fireflywellness | AI guess | Our record | |
| Links | https://instagram.com/fireflyspasd | AI guess | Our record | |
| Links | TikTok | https://tiktok.com/@fireflyspasd | AI guess | Our record |
| Links | Website | https://fireflywellnessdayspa.com/ | Confirmed | Google Business Profile |
Services and prices
These are the 31 services Firefly Wellness offers, with the price where we have one and where it came from.
| Service | Price | Price mark | Price evidence | Service mark |
|---|---|---|---|---|
| Facials | From their website | |||
| Confirmation | From their website | |||
| Womens history month | From their website | |||
| Brazilian wax | From their website | |||
| Cancellation policy | From their website | |||
| Firefly focus may edition | From their website | |||
| Celluma LED light therapy | From their website | |||
| Acne awareness month | From their website | |||
| Spring awakening | From their website | |||
| Covid 19 safety measures | From their website | |||
| Mens facials | From their website | |||
| Microneedling | From their website | |||
| Acupuncture | From their website | |||
| Firefly links | From their website | |||
| Hot stone massage | From their website | |||
| Firefly focus april edition | From their website | |||
| Microneedling frequently asked questions answered | From their website | |||
| National sunscreen day | From their website | |||
| October firefly focus | From their website | |||
| Peels prosecco | From their website | |||
| Prenatal massage | From their website | |||
| September firefly focus | From their website | |||
| Spring skincare | From their website | |||
| Swedish massage | Confirmed | |||
| Valentines weekend couples massage | From their website | |||
| Collagen facial | From their website | |||
| Firefly focus august edition | From their website | |||
| Firefly focus february edition | From their website | |||
| Firefly focus july edition | From their website | |||
| Firefly focus march edition | From their website | |||
| CBD oil | Confirmed |
Known for
- Facials: 40% of reviews (AI guess)
The team
Visiting Firefly Wellness
Address: 4024 Ibis St Ste a, San Diego, CA 92103, USA. Phone: (619) 693-8568. Hours: Mon to Sat 10 AM to 8 PM · Sun 11 AM to 5 PM. (Confirmed, Google Business Profile.)
Location info from Google Business Profile
From Google Business Profile: "Firefly Spa is a boutique neighborhood spa in Mission Hills, San Diego. Offering customized massage, acupuncture, facials, waxing and lash extensions. Signature services include deep tissue massage, prenatal massage, couples massage and Swedish massage, with enhancements like hot stones, cupping, and CBD oil. Our estheticians provide relaxing, results-driven facials featuring dermaplaning, LED red light therapy, and collagen masks to leave your skin glowing. Locals from Mission Hills, Little Italy, Hillcrest, Old Town, Bankers Hill, North Park, University Heights and Downtown San Diego choose Firefly Spa for consistent, high-quality self-care. Whether you're booking a monthly facial or weekly massage, your wellness journey starts here!"
Parking and getting in
Add your parking so AI can tell people where to parkAdd how to find your door so AI can walk people in
Nearby
| Place | Type | Distance |
|---|---|---|
| Fort Oak | American restaurant | 2 min walk |
| Hawk St & Fort Stockton Dr | Bus stop | 2 min walk |
| Hawk St & Fort Stockton Dr | Transit station | 2 min walk |
| Hawk St & Fort Stockton Dr | Bus stop | 2 min walk |
| What De Health Thai | Thai restaurant | 2 min walk |
| Izakaya Masa | Izakaya restaurant | 3 min walk |
Reputation
4.9 average across 170 reviews: Google 170. (Confirmed, read October 9, 2026.)
Firefly Wellness Day Spa is distinguished by its personalized treatment plans and a wide variety of wellness services. (AI guess, from 170 reviews.)
What people like
- Deep tissue massages
- Hydrating facials
- Personalized treatment plans
- Clean and calming environment
- Exceptional customer service
What people do not like
- Uncomfortable pressure during massages
- Noise from outside during treatments
- Restrictions on new clients for certain services
Press
Awards
Directories
Questions people ask
does Firefly Wellness ever have cancellations
where exactly is Firefly Wellness?
what has this salon posted recently, I am not on Instagram
Are the hours on Google right for Firefly Wellness in San Diego?
Calling Firefly Wellness, or is there a better way?
Anything this salon is known for doing well?
is there a way to spread the cost here
how far out is this salon booking right now?
killing time on Ibis, any ideas
budget options in San Diego, what is decent
Street parking near here, any good?
torn between Firefly Wellness and Karma Wellness?
anyone at Firefly Wellness people keep going back to?
trying to avoid the rush, which day is quiet
booked my first appointment here, how does it go
best day spa in San Diego, CA
Any membership pricing at Firefly Wellness?
bad experiences at Firefly Wellness, anyone?
do they do Saturdays
Booking a first appointment here, what happens?
The AI Score: 32 of 100
It measures how likely AI engines are to recommend a business, and how accurately. San Diego day spas run 25 to 32. Fair starts at 45, good at 65. Firefly Wellness scores 32, above the San Diego average of 26. The same method scores every business on the registry.
| Signal | Weight | Score | What it measures | Firefly Wellness |
|---|---|---|---|---|
| Retrieval grounding | 26 | 18 | Whether you appear in the ranked results AI retrieves and cites: AI-Overview citations, organic top-10 for your money queries, and the Bing index ChatGPT leans on. | Poor |
| Off-property attestation | 20 | 42 | Volume and consistency of what others say about you: YouTube mentions, branded web mentions, third-party “best-of” lists. The cause of retrievability. | Poor |
| AI visibility | 14 | 0 | Whether ChatGPT, Gemini, Perplexity, and AI Overviews name you, and whether they name you for the right service. | Poor |
| Reviews & response | 12 | 94 | The star average is only one input. We also read volume, velocity, the specificity of review language, and response cadence. Specific reviews are what AI quotes verbatim. | Good |
| Backlink & citation authority | 8 | 56 | Domain authority and editorial quality of the sources that attest to you. | Fair |
| Google Business Profile | 8 | 90 | Required and recommended fields; update cadence. The listing AI pulls from first. | Good |
| Speed & mobile | 7 | 30 | Core Web Vitals at the 75th percentile, on a real phone. | Poor |
| Content freshness & schema | 5 | 83 | Crawl recency, intent alignment, valid JSON-LD, canonicals. | Good |
Full method: https://localairegistry.com/methodology
How AI decides what to say about a day spa: https://localairegistry.com/methodology#how-ai-decides-local-business. What to check before you choose one: https://localairegistry.com/methodology#how-to-choose-local-business
Entity map
Every person, place, organization and treatment named on this page, with a stable ID and a public reference. The JSON-LD below connects them to each other.
| Entity | Type | ID on this page | Same as | Relationship to Firefly Wellness |
|---|---|---|---|---|
| Firefly Wellness Day Spa | LocalBusiness | #business | https://fireflywellnessdayspa.com/ | Subject of this page |
| Dermaplaning | Service | #service-dermaplaning | https://en.wikipedia.org/wiki/Dermaplaning | Service offered |
| Microneedling | Service | #service-microneedling | https://en.wikipedia.org/wiki/Collagen_induction_therapy | Service offered |
| San Diego, California | City | #city | City Firefly Wellness is in | |
| Local AI Registry | Organization | #publisher | https://localairegistry.com | Publisher of this page |
| Steve Lee | Person | #author | https://localairegistry.com/team/steve-lee | Author of this page |
Topical map
Where this page sits in the registry. It's one profile among the day spas in San Diego, linked to the lists and towns around it.
Lists
- Best day spas in San Diego: https://localairegistry.com/leaderboards/ca/san-diego/day-spa
- Best businesses in San Diego: https://localairegistry.com/leaderboards/ca/san-diego
Nearby
- /san-jose: https://localairegistry.com/leaderboards/ca/san-jose
- /los-angeles: https://localairegistry.com/leaderboards/ca/los-angeles
- /san-francisco: https://localairegistry.com/leaderboards/ca/san-francisco
- /irvine: https://localairegistry.com/leaderboards/ca/irvine
- /mountain-view: https://localairegistry.com/leaderboards/ca/mountain-view
- /santa-clara: https://localairegistry.com/leaderboards/ca/santa-clara
Every list
- Every leaderboard in California: https://localairegistry.com/leaderboards/ca
References
Show references (32)
Sources cited
- [1] Google Business Profile, https://www.google.com/maps/place/?q=place_id:ChIJXb13UoZV2YARD0PSazrQt2A (accessed Oct 9, 2026)
- [2] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/womens-history-month/ (accessed Oct 25, 2026)
- [3] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/acupuncture-at-firefly-spa-in-san-diego/ (accessed Oct 25, 2026)
- [4] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/brazilian-wax/ (accessed Oct 25, 2026)
- [5] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/cancellation-policy/ (accessed Oct 25, 2026)
- [6] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/celluma-led-light-therapy/ (accessed Oct 25, 2026)
- [7] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/collagen-facial/ (accessed Oct 25, 2026)
- [8] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/confirmation/ (accessed Oct 25, 2026)
- [9] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/spring-awakening/ (accessed Oct 25, 2026)
- [10] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/spring-skincare/ (accessed Oct 25, 2026)
- [11] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/valentines-weekend-couples-massage/ (accessed Oct 25, 2026)
- [12] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/acne-awareness-month/ (accessed Oct 25, 2026)
- [13] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/covid-19-safety-measures/ (accessed Oct 25, 2026)
- [14] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/facials-at-firefly-spa-in-san-diego/ (accessed Oct 25, 2026)
- [15] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-april-edition/ (accessed Oct 25, 2026)
- [16] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-august-edition/ (accessed Oct 25, 2026)
- [17] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-february-edition/ (accessed Oct 25, 2026)
- [18] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-july-edition/ (accessed Oct 25, 2026)
- [19] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-march-edition/ (accessed Oct 25, 2026)
- [20] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-may-edition/ (accessed Oct 25, 2026)
- [21] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-links/ (accessed Oct 25, 2026)
- [22] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/hot-stone-massage/ (accessed Oct 25, 2026)
- [23] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/mens-facials/ (accessed Oct 25, 2026)
- [24] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/microneedling-at-firefly-spa-in-san-diego/ (accessed Oct 25, 2026)
- [25] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/microneedling-frequently-asked-questions-answered/ (accessed Oct 25, 2026)
- [26] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/national-sunscreen-day/ (accessed Oct 25, 2026)
- [27] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/new-client-specials/ (accessed Oct 25, 2026)
- [28] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/october-firefly-focus/ (accessed Oct 25, 2026)
- [29] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/peels-prosecco/ (accessed Oct 25, 2026)
- [30] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/prenatal-massage/ (accessed Oct 25, 2026)
- [31] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/september-firefly-focus/ (accessed Oct 25, 2026)
- [32] AI engine output: ChatGPT and Gemini, read by Local AI Registry on Oct 9, 2026, https://localairegistry.com/methodology (accessed Oct 25, 2026)
The code behind this page
This is exactly what this page sends to Google, Bing, ChatGPT, Claude, Perplexity and Gemini. We publish it in the open for two reasons: so you can see nothing here is hidden or made up, and so any business or developer can copy it. Being a good local AI steward means the machine version says exactly what the human version says.
1. HTTP response headers
Sent before the page. They tell crawlers the canonical address and that a plain markdown copy exists.
HTTP/2 200 content-type: text/html; charset=utf-8 link: <https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca>; rel="canonical", <https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca.md>; rel="alternate"; type="text/markdown", <https://localairegistry.com/llms.txt>; rel="describedby"
2. Head tags
Title, description, canonical, robots and Open Graph tags. This is what shows in search results and link previews.
<meta charset="utf-8"> <meta name="viewport" content="width=device-width, initial-scale=1"> <title>Firefly Wellness Day Spa, San Diego CA: Facials Reviews</title> <meta name="description" content="Day spa in San Diego, CA. 4.9 on Google from 170 reviews. Known for Facials."> <meta name="robots" content="index, follow"> <link rel="canonical" href="https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca"> <link rel="alternate" type="text/markdown" href="https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca.md"> <meta property="og:title" content="Firefly Wellness Day Spa, San Diego CA: Facials Reviews"> <meta property="og:description" content="Day spa in San Diego, CA. 4.9 on Google from 170 reviews. Known for Facials."> <meta property="og:url" content="https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca"> <meta property="og:site_name" content="Local AI Registry"> <meta property="og:type" content="website"> <meta name="twitter:card" content="summary_large_image"> <meta name="geo.position" content="32.75044080000001;-117.1735086"> <meta name="ICBM" content="32.75044080000001, -117.1735086"> <meta name="geo.region" content="US-CA"> <meta name="geo.placename" content="San Diego">
3. Structured data (JSON-LD)
One connected graph. Every person and service has its own @id and links to the business, and a licensed person links to the license and the board that issued it.
{
"@context": "https://schema.org",
"@graph": [
{
"@type": "WebPage",
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#webpage",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca",
"name": "Firefly Wellness Day Spa, San Diego CA: Facials Reviews",
"isPartOf": {
"@id": "https://localairegistry.com/#website"
},
"about": {
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca"
},
"mainEntity": {
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca"
},
"breadcrumb": {
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#breadcrumb"
},
"hasPart": {
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#locals"
},
"primaryImageOfPage": {
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-1"
},
"datePublished": "2026-10-09",
"dateModified": "2026-10-31",
"speakable": {
"@type": "SpeakableSpecification",
"cssSelector": [
"#ai-listing-description"
]
},
"significantLink": [
"https://localairegistry.com/methodology",
"https://localairegistry.com/faq",
"https://localairegistry.com/developers"
]
},
{
"@type": "Article",
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#article",
"headline": "Firefly Wellness Day Spa, San Diego CA: Facials Reviews",
"name": "Firefly Wellness Day Spa, San Diego CA: Facials Reviews",
"author": {
"@id": "https://localairegistry.com/team/steve-lee"
},
"publisher": {
"@id": "https://localairegistry.com/#organization"
},
"datePublished": "2026-10-09",
"dateModified": "2026-10-31",
"about": {
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca"
},
"image": {
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-1"
},
"isPartOf": {
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#webpage"
},
"mainEntityOfPage": {
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#webpage"
}
},
{
"@type": "Person",
"@id": "https://localairegistry.com/team/steve-lee",
"name": "Steve Lee",
"jobTitle": "Founder and CEO",
"url": "https://localairegistry.com/team/steve-lee",
"worksFor": {
"@id": "https://localairegistry.com/#organization"
}
},
{
"@type": "Organization",
"@id": "https://localairegistry.com/#organization",
"name": "Local AI Registry",
"alternateName": "LAIR",
"url": "https://localairegistry.com/",
"logo": "https://localairegistry.com/images/brand/logo-512.png"
},
{
"@type": "DaySpa",
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca",
"name": "Firefly Wellness Day Spa",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca",
"description": "Firefly Spa is a boutique neighborhood spa in Mission Hills, San Diego. Offering customized massage, acupuncture, facials, waxing and lash extensions. Signature services include deep tissue massage, prenatal massage, couples massage and Swedish massage, with enhancements like hot stones, cupping, and CBD oil. Our estheticians provide relaxing, results-driven facials featuring dermaplaning, LED red light therapy, and collagen masks to leave your skin glowing. Locals from Mission Hills, Little Italy, Hillcrest, Old Town, Bankers Hill, North Park, University Heights and Downtown San Diego choose Firefly Spa for consistent, high-quality self-care. Whether you're booking a monthly facial or weekly massage, your wellness journey starts here.",
"sameAs": [
"https://fireflywellnessdayspa.com/",
"https://www.google.com/maps/place/?q=place_id:ChIJXb13UoZV2YARD0PSazrQt2A"
],
"image": [
{
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-1"
},
{
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-2"
},
{
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-3"
},
{
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-4"
},
{
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-5"
}
],
"hasMap": "https://www.google.com/maps/place/?q=place_id:ChIJXb13UoZV2YARD0PSazrQt2A",
"geo": {
"@type": "GeoCoordinates",
"latitude": 32.75044080000001,
"longitude": -117.1735086
},
"aggregateRating": {
"@type": "AggregateRating",
"ratingValue": 4.9,
"reviewCount": 170,
"bestRating": 5
},
"telephone": "(619) 693-8568",
"address": {
"@type": "PostalAddress",
"streetAddress": "4024 Ibis St Ste a, San Diego, CA 92103, USA",
"addressLocality": "San Diego",
"addressRegion": "CA",
"postalCode": "92103",
"addressCountry": "US"
},
"openingHoursSpecification": [
{
"@type": "OpeningHoursSpecification",
"dayOfWeek": "https://schema.org/Monday",
"opens": "10:00",
"closes": "20:00"
},
{
"@type": "OpeningHoursSpecification",
"dayOfWeek": "https://schema.org/Tuesday",
"opens": "10:00",
"closes": "20:00"
},
{
"@type": "OpeningHoursSpecification",
"dayOfWeek": "https://schema.org/Wednesday",
"opens": "10:00",
"closes": "20:00"
},
{
"@type": "OpeningHoursSpecification",
"dayOfWeek": "https://schema.org/Thursday",
"opens": "10:00",
"closes": "20:00"
},
{
"@type": "OpeningHoursSpecification",
"dayOfWeek": "https://schema.org/Friday",
"opens": "10:00",
"closes": "20:00"
},
{
"@type": "OpeningHoursSpecification",
"dayOfWeek": "https://schema.org/Saturday",
"opens": "10:00",
"closes": "20:00"
},
{
"@type": "OpeningHoursSpecification",
"dayOfWeek": "https://schema.org/Sunday",
"opens": "11:00",
"closes": "17:00"
}
],
"areaServed": {
"@type": "City",
"name": "San Diego"
},
"knowsAbout": [
"Acne awareness month",
"Acupuncture",
"Brazilian wax",
"Cancellation policy",
"CBD oil",
"Celluma led light therapy",
"Collagen facial",
"Confirmation",
"Couples massage",
"Covid 19 safety measures",
"Customized massage",
"Deep tissue massage",
"Dermaplaning",
"Facials",
"Firefly focus april edition",
"Firefly focus august edition",
"Firefly focus february edition",
"Firefly focus july edition",
"Firefly focus march edition",
"Firefly focus may edition",
"Firefly links",
"Hot stone massage",
"Lash extensions",
"LED red light therapy",
"Mens facials",
"Microneedling",
"Microneedling frequently asked questions answered",
"National sunscreen day",
"October firefly focus",
"Peels prosecco",
"Prenatal massage",
"September firefly focus",
"Spring awakening",
"Spring skincare",
"Swedish massage",
"Valentines weekend couples massage",
"Waxing",
"Womens history month"
]
},
{
"@type": "ImageObject",
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-1",
"contentUrl": "https://localairegistry.com/api/photo?src=https%3A%2F%2Fseoaesthetic-assets.sfo3.cdn.digitaloceanspaces.com%2Fphotos%2Fcmv1notue0dalyea7rw5li224%2F0.jpg",
"caption": "Photo 1"
},
{
"@type": "ImageObject",
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-2",
"contentUrl": "https://localairegistry.com/api/photo?src=https%3A%2F%2Fseoaesthetic-assets.sfo3.cdn.digitaloceanspaces.com%2Fphotos%2Fcmv1notue0dalyea7rw5li224%2F1.jpg",
"caption": "Photo 2"
},
{
"@type": "ImageObject",
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-3",
"contentUrl": "https://localairegistry.com/api/photo?src=https%3A%2F%2Fseoaesthetic-assets.sfo3.cdn.digitaloceanspaces.com%2Fphotos%2Fcmv1notue0dalyea7rw5li224%2F2.jpg",
"caption": "Photo 3"
},
{
"@type": "ImageObject",
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-4",
"contentUrl": "https://localairegistry.com/api/photo?src=https%3A%2F%2Fseoaesthetic-assets.sfo3.cdn.digitaloceanspaces.com%2Fphotos%2Fcmv1notue0dalyea7rw5li224%2F3.jpg",
"caption": "Photo 4"
},
{
"@type": "ImageObject",
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-5",
"contentUrl": "https://localairegistry.com/api/photo?src=https%3A%2F%2Fseoaesthetic-assets.sfo3.cdn.digitaloceanspaces.com%2Fphotos%2Fcmv1notue0dalyea7rw5li224%2F4.jpg",
"caption": "Photo 5"
},
{
"@type": "ItemList",
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#locals",
"name": "Questions people ask",
"numberOfItems": 20,
"itemListElement": [
{
"@type": "ListItem",
"position": 1,
"name": "does Firefly Wellness ever have cancellations",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/does-firefly-wellness-ever-have-cancellations"
},
{
"@type": "ListItem",
"position": 2,
"name": "where exactly is Firefly Wellness?",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/where-exactly-is-firefly-wellness"
},
{
"@type": "ListItem",
"position": 3,
"name": "what has this salon posted recently, I am not on Instagram",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/what-has-this-salon-posted-recently-i-am-not-on-instagram"
},
{
"@type": "ListItem",
"position": 4,
"name": "Are the hours on Google right for Firefly Wellness in San Diego?",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/are-the-hours-on-google-right-for-firefly-wellness-in-san-diego"
},
{
"@type": "ListItem",
"position": 5,
"name": "Calling Firefly Wellness, or is there a better way?",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/how-do-i-reach-firefly-wellness-to-sort-something-out"
},
{
"@type": "ListItem",
"position": 6,
"name": "Anything this salon is known for doing well?",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/anything-this-salon-is-known-for-doing-well"
},
{
"@type": "ListItem",
"position": 7,
"name": "is there a way to spread the cost here",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/is-there-a-way-to-spread-the-cost-here"
},
{
"@type": "ListItem",
"position": 8,
"name": "how far out is this salon booking right now?",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/can-i-get-in-this-week-here"
},
{
"@type": "ListItem",
"position": 9,
"name": "killing time on Ibis, any ideas",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/killing-time-on-ibis-any-ideas"
},
{
"@type": "ListItem",
"position": 10,
"name": "budget options in San Diego, what is decent",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/budget-options-in-san-diego-what-is-decent"
},
{
"@type": "ListItem",
"position": 11,
"name": "Street parking near here, any good?",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/anyone-had-trouble-parking-round-here"
},
{
"@type": "ListItem",
"position": 12,
"name": "torn between Firefly Wellness and Karma Wellness?",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/torn-between-firefly-wellness-and-spa-kingston"
},
{
"@type": "ListItem",
"position": 13,
"name": "anyone at Firefly Wellness people keep going back to?",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/regulars-here-who-do-you-book-with"
},
{
"@type": "ListItem",
"position": 14,
"name": "trying to avoid the rush, which day is quiet",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/trying-to-avoid-the-rush-which-day-is-quiet"
},
{
"@type": "ListItem",
"position": 15,
"name": "booked my first appointment here, how does it go",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/booked-my-first-appointment-here-how-does-it-go"
},
{
"@type": "ListItem",
"position": 16,
"name": "best day spa in San Diego, CA",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/best-day-spa-in-san-diego-ca"
},
{
"@type": "ListItem",
"position": 17,
"name": "Any membership pricing at Firefly Wellness?",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/any-membership-pricing-at-firefly-wellness"
},
{
"@type": "ListItem",
"position": 18,
"name": "bad experiences at Firefly Wellness, anyone?",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/bad-experiences-at-firefly-wellness-anyone"
},
{
"@type": "ListItem",
"position": 19,
"name": "do they do Saturdays",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/do-they-do-saturdays"
},
{
"@type": "ListItem",
"position": 20,
"name": "Booking a first appointment here, what happens?",
"url": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/booking-a-first-appointment-here-what-happens"
}
]
},
{
"@type": "BreadcrumbList",
"@id": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#breadcrumb",
"itemListElement": [
{
"@type": "ListItem",
"position": 1,
"name": "Home",
"item": "https://localairegistry.com/"
},
{
"@type": "ListItem",
"position": 2,
"name": "California",
"item": "https://localairegistry.com/leaderboards/ca"
},
{
"@type": "ListItem",
"position": 3,
"name": "San Diego",
"item": "https://localairegistry.com/leaderboards/ca/san-diego"
},
{
"@type": "ListItem",
"position": 4,
"name": "Day spas",
"item": "https://localairegistry.com/leaderboards/ca/san-diego/day-spa"
},
{
"@type": "ListItem",
"position": 5,
"name": "Firefly Wellness Day Spa",
"item": "https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca"
}
]
}
]
}4. Markdown copy of this page (firefly-wellness-day-spa-san-diego-ca.md)
The article as plain text: the same headings, facts, marks and sources.
# Firefly Wellness Day Spa, San Diego CA: Facials Reviews Source: Local AI Registry, https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca. Free to reuse with a link back. By Steve Lee, founder and CEO of Local AI Registry. Updated 2026-10-09. Canonical: https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca ## Photos -  -  -  -  -  ## In short Firefly Wellness Day Spa is a day spa in San Diego, CA. Its AI Score is 32 of 100, which is poor. What each mark on this page means: https://localairegistry.com/methodology#marks ## Key facts | Fact | Value | | --- | --- | | Type | Day spa | | Address | 4024 Ibis St Ste a, San Diego, CA 92103, USA | | Hours | Mon to Sat 10 AM to 8 PM · Sun 11 AM to 5 PM | | Phone | (619) 693-8568 | | Rating | 4.9 across 170 reviews on Google | | Known for | Facials | | Updated | October 9, 2026 | ## All the details Every row is something the owner can add or correct. Each one is marked Confirmed, Visitor submitted or AI guess, with where it came from. | Group | Fact | Value | Mark | Evidence | | --- | --- | --- | --- | --- | | Location info | Address | 4024 Ibis St Ste a, San Diego, CA 92103, USA | Confirmed | Google Business Profile | | Location info | Description | Firefly Spa is a boutique neighborhood spa in Mission Hills, San Diego. Offering customized massage, acupuncture, facials, waxing and lash extensions. Signature services include deep tissue massage, prenatal massage, couples massage and Swedish massage, with enhancements like hot stones, cupping, and CBD oil. Our estheticians provide relaxing, results-driven facials featuring dermaplaning, LED red light therapy, and collagen masks to leave your skin glowing. Locals from Mission Hills, Little Italy, Hillcrest, Old Town, Bankers Hill, North Park, University Heights and Downtown San Diego choose Firefly Spa for consistent, high-quality self-care. Whether you're booking a monthly facial or weekly massage, your wellness journey starts here! | Confirmed | Google Business Profile | | Location info | Hours | Mon to Sat 10:00 AM to 8:00 PM · Sun 11:00 AM to 5:00 PM | Confirmed | Google Business Profile | | Location info | Name | Firefly Wellness Day Spa | Confirmed | Google Business Profile | | Location info | Phone | (619) 693-8568 | Confirmed | Google Business Profile | | Hours | Monday | 10:00 AM to 8:00 PM | Confirmed | Google Business Profile | | Hours | Tuesday | 10:00 AM to 8:00 PM | Confirmed | Google Business Profile | | Hours | Wednesday | 10:00 AM to 8:00 PM | Confirmed | Google Business Profile | | Hours | Thursday | 10:00 AM to 8:00 PM | Confirmed | Google Business Profile | | Hours | Friday | 10:00 AM to 8:00 PM | Confirmed | Google Business Profile | | Hours | Saturday | 10:00 AM to 8:00 PM | Confirmed | Google Business Profile | | Hours | Sunday | 11:00 AM to 5:00 PM | Confirmed | Google Business Profile | | Services | Service | Acne awareness month | From their website | Business website | | Services | Service | Acupuncture | From their website | Business website | | Services | Service | Brazilian wax | From their website | Business website | | Services | Service | Cancellation policy | From their website | Business website | | Services | Service | CBD oil | Confirmed | Google Business Profile | | Services | Service | Celluma led light therapy | From their website | Business website | | Services | Service | Collagen facial | From their website | Business website | | Services | Service | Confirmation | From their website | Business website | | Services | Service | Couples massage | AI guess | | | Services | Service | Covid 19 safety measures | From their website | Business website | | Services | Service | Customized massage | AI guess | | | Services | Service | Deep tissue massage | AI guess | | | Services | Service | Dermaplaning | AI guess | | | Services | Service | Facials | From their website | Business website | | Services | Service | Firefly focus april edition | From their website | Business website | | Services | Service | Firefly focus august edition | From their website | Business website | | Services | Service | Firefly focus february edition | From their website | Business website | | Services | Service | Firefly focus july edition | From their website | Business website | | Services | Service | Firefly focus march edition | From their website | Business website | | Services | Service | Firefly focus may edition | From their website | Business website | | Services | Service | Firefly links | From their website | Business website | | Services | Service | Hot stone massage | From their website | Business website | | Services | Service | Lash extensions | AI guess | | | Services | Service | LED red light therapy | AI guess | | | Services | Service | Mens facials | From their website | Business website | | Services | Service | Microneedling | From their website | Business website | | Services | Service | Microneedling frequently asked questions answered | From their website | Business website | | Services | Service | National sunscreen day | From their website | Business website | | Services | Service | October firefly focus | From their website | Business website | | Services | Service | Peels prosecco | From their website | Business website | | Services | Service | Prenatal massage | From their website | Business website | | Services | Service | September firefly focus | From their website | Business website | | Services | Service | Spring awakening | From their website | Business website | | Services | Service | Spring skincare | From their website | Business website | | Services | Service | Swedish massage | Confirmed | Google Business Profile | | Services | Service | Valentines weekend couples massage | From their website | Business website | | Services | Service | Waxing | AI guess | | | Services | Service | Womens history month | From their website | Business website | | Links | Facebook | https://facebook.com/fireflywellness | AI guess | Our record | | Links | Instagram | https://instagram.com/fireflyspasd | AI guess | Our record | | Links | TikTok | https://tiktok.com/@fireflyspasd | AI guess | Our record | | Links | Website | https://fireflywellnessdayspa.com/ | Confirmed | Google Business Profile | ## Services and prices These are the 31 services Firefly Wellness offers, with the price where we have one and where it came from. | Service | Price | Price mark | Price evidence | Service mark | | --- | --- | --- | --- | --- | | Facials | | | | From their website | | Confirmation | | | | From their website | | Womens history month | | | | From their website | | Brazilian wax | | | | From their website | | Cancellation policy | | | | From their website | | Firefly focus may edition | | | | From their website | | Celluma LED light therapy | | | | From their website | | Acne awareness month | | | | From their website | | Spring awakening | | | | From their website | | Covid 19 safety measures | | | | From their website | | Mens facials | | | | From their website | | Microneedling | | | | From their website | | Acupuncture | | | | From their website | | Firefly links | | | | From their website | | Hot stone massage | | | | From their website | | Firefly focus april edition | | | | From their website | | Microneedling frequently asked questions answered | | | | From their website | | National sunscreen day | | | | From their website | | October firefly focus | | | | From their website | | Peels prosecco | | | | From their website | | Prenatal massage | | | | From their website | | September firefly focus | | | | From their website | | Spring skincare | | | | From their website | | Swedish massage | | | | Confirmed | | Valentines weekend couples massage | | | | From their website | | Collagen facial | | | | From their website | | Firefly focus august edition | | | | From their website | | Firefly focus february edition | | | | From their website | | Firefly focus july edition | | | | From their website | | Firefly focus march edition | | | | From their website | | CBD oil | | | | Confirmed | ### Known for - Facials: 40% of reviews (AI guess) ## The team Add your team so AI can name who works here ## Visiting Firefly Wellness Address: 4024 Ibis St Ste a, San Diego, CA 92103, USA. Phone: (619) 693-8568. Hours: Mon to Sat 10 AM to 8 PM · Sun 11 AM to 5 PM. (Confirmed, Google Business Profile.) ### Location info from Google Business Profile From Google Business Profile: "Firefly Spa is a boutique neighborhood spa in Mission Hills, San Diego. Offering customized massage, acupuncture, facials, waxing and lash extensions. Signature services include deep tissue massage, prenatal massage, couples massage and Swedish massage, with enhancements like hot stones, cupping, and CBD oil. Our estheticians provide relaxing, results-driven facials featuring dermaplaning, LED red light therapy, and collagen masks to leave your skin glowing. Locals from Mission Hills, Little Italy, Hillcrest, Old Town, Bankers Hill, North Park, University Heights and Downtown San Diego choose Firefly Spa for consistent, high-quality self-care. Whether you're booking a monthly facial or weekly massage, your wellness journey starts here!" ### Parking and getting in Add your parking so AI can tell people where to park Add how to find your door so AI can walk people in ### Nearby | Place | Type | Distance | | --- | --- | --- | | Fort Oak | American restaurant | 2 min walk | | Hawk St & Fort Stockton Dr | Bus stop | 2 min walk | | Hawk St & Fort Stockton Dr | Transit station | 2 min walk | | Hawk St & Fort Stockton Dr | Bus stop | 2 min walk | | What De Health Thai | Thai restaurant | 2 min walk | | Izakaya Masa | Izakaya restaurant | 3 min walk | ## Reputation 4.9 average across 170 reviews: Google 170. (Confirmed, read October 9, 2026.) Firefly Wellness Day Spa is distinguished by its personalized treatment plans and a wide variety of wellness services. (AI guess, from 170 reviews.) ### What people like - Deep tissue massages - Hydrating facials - Personalized treatment plans - Clean and calming environment - Exceptional customer service ### What people do not like - Uncomfortable pressure during massages - Noise from outside during treatments - Restrictions on new clients for certain services ### Press Add a press story so AI can say who's written about you ### Awards Add an award so AI can name it ### Directories Get listed in directories so AI can tell you're real ## Questions people ask ### does Firefly Wellness ever have cancellations ### where exactly is Firefly Wellness? ### what has this salon posted recently, I am not on Instagram ### Are the hours on Google right for Firefly Wellness in San Diego? ### Calling Firefly Wellness, or is there a better way? ### Anything this salon is known for doing well? ### is there a way to spread the cost here ### how far out is this salon booking right now? ### killing time on Ibis, any ideas ### budget options in San Diego, what is decent ### Street parking near here, any good? ### torn between Firefly Wellness and Karma Wellness? ### anyone at Firefly Wellness people keep going back to? ### trying to avoid the rush, which day is quiet ### booked my first appointment here, how does it go ### best day spa in San Diego, CA ### Any membership pricing at Firefly Wellness? ### bad experiences at Firefly Wellness, anyone? ### do they do Saturdays ### Booking a first appointment here, what happens? ## The AI Score: 32 of 100 It measures how likely AI engines are to recommend a business, and how accurately. San Diego day spas run 25 to 32. Fair starts at 45, good at 65. Firefly Wellness scores 32, above the San Diego average of 26. The same method scores every business on the registry. | Signal | Weight | Score | What it measures | Firefly Wellness | | --- | --- | --- | --- | --- | | Retrieval grounding | 26 | 18 | Whether you appear in the ranked results AI retrieves and cites: AI-Overview citations, organic top-10 for your money queries, and the Bing index ChatGPT leans on. | Poor | | Off-property attestation | 20 | 42 | Volume and consistency of what others say about you: YouTube mentions, branded web mentions, third-party “best-of” lists. The cause of retrievability. | Poor | | AI visibility | 14 | 0 | Whether ChatGPT, Gemini, Perplexity, and AI Overviews name you, and whether they name you for the right service. | Poor | | Reviews & response | 12 | 94 | The star average is only one input. We also read volume, velocity, the specificity of review language, and response cadence. Specific reviews are what AI quotes verbatim. | Good | | Backlink & citation authority | 8 | 56 | Domain authority and editorial quality of the sources that attest to you. | Fair | | Google Business Profile | 8 | 90 | Required and recommended fields; update cadence. The listing AI pulls from first. | Good | | Speed & mobile | 7 | 30 | Core Web Vitals at the 75th percentile, on a real phone. | Poor | | Content freshness & schema | 5 | 83 | Crawl recency, intent alignment, valid JSON-LD, canonicals. | Good | Full method: https://localairegistry.com/methodology How AI decides what to say about a day spa: https://localairegistry.com/methodology#how-ai-decides-local-business. What to check before you choose one: https://localairegistry.com/methodology#how-to-choose-local-business ## Entity map Every person, place, organization and treatment named on this page, with a stable ID and a public reference. The JSON-LD below connects them to each other. | Entity | Type | ID on this page | Same as | Relationship to Firefly Wellness | | --- | --- | --- | --- | --- | | Firefly Wellness Day Spa | LocalBusiness | #business | https://fireflywellnessdayspa.com/ | Subject of this page | | Dermaplaning | Service | #service-dermaplaning | https://en.wikipedia.org/wiki/Dermaplaning | Service offered | | Microneedling | Service | #service-microneedling | https://en.wikipedia.org/wiki/Collagen_induction_therapy | Service offered | | San Diego, California | City | #city | | City Firefly Wellness is in | | Local AI Registry | Organization | #publisher | https://localairegistry.com | Publisher of this page | | Steve Lee | Person | #author | https://localairegistry.com/team/steve-lee | Author of this page | ## Topical map Where this page sits in the registry. It's one profile among the day spas in San Diego, linked to the lists and towns around it. ### Lists - Best day spas in San Diego: https://localairegistry.com/leaderboards/ca/san-diego/day-spa - Best businesses in San Diego: https://localairegistry.com/leaderboards/ca/san-diego ### Nearby - /san-jose: https://localairegistry.com/leaderboards/ca/san-jose - /los-angeles: https://localairegistry.com/leaderboards/ca/los-angeles - /san-francisco: https://localairegistry.com/leaderboards/ca/san-francisco - /irvine: https://localairegistry.com/leaderboards/ca/irvine - /mountain-view: https://localairegistry.com/leaderboards/ca/mountain-view - /santa-clara: https://localairegistry.com/leaderboards/ca/santa-clara ### Every list - Every leaderboard in California: https://localairegistry.com/leaderboards/ca ## References ### Sources cited - [1] Google Business Profile, https://www.google.com/maps/place/?q=place_id:ChIJXb13UoZV2YARD0PSazrQt2A (accessed Oct 9, 2026) - [2] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/womens-history-month/ (accessed Oct 25, 2026) - [3] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/acupuncture-at-firefly-spa-in-san-diego/ (accessed Oct 25, 2026) - [4] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/brazilian-wax/ (accessed Oct 25, 2026) - [5] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/cancellation-policy/ (accessed Oct 25, 2026) - [6] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/celluma-led-light-therapy/ (accessed Oct 25, 2026) - [7] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/collagen-facial/ (accessed Oct 25, 2026) - [8] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/confirmation/ (accessed Oct 25, 2026) - [9] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/spring-awakening/ (accessed Oct 25, 2026) - [10] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/spring-skincare/ (accessed Oct 25, 2026) - [11] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/valentines-weekend-couples-massage/ (accessed Oct 25, 2026) - [12] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/acne-awareness-month/ (accessed Oct 25, 2026) - [13] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/covid-19-safety-measures/ (accessed Oct 25, 2026) - [14] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/facials-at-firefly-spa-in-san-diego/ (accessed Oct 25, 2026) - [15] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-april-edition/ (accessed Oct 25, 2026) - [16] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-august-edition/ (accessed Oct 25, 2026) - [17] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-february-edition/ (accessed Oct 25, 2026) - [18] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-july-edition/ (accessed Oct 25, 2026) - [19] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-march-edition/ (accessed Oct 25, 2026) - [20] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-may-edition/ (accessed Oct 25, 2026) - [21] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-links/ (accessed Oct 25, 2026) - [22] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/hot-stone-massage/ (accessed Oct 25, 2026) - [23] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/mens-facials/ (accessed Oct 25, 2026) - [24] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/microneedling-at-firefly-spa-in-san-diego/ (accessed Oct 25, 2026) - [25] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/microneedling-frequently-asked-questions-answered/ (accessed Oct 25, 2026) - [26] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/national-sunscreen-day/ (accessed Oct 25, 2026) - [27] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/new-client-specials/ (accessed Oct 25, 2026) - [28] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/october-firefly-focus/ (accessed Oct 25, 2026) - [29] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/peels-prosecco/ (accessed Oct 25, 2026) - [30] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/prenatal-massage/ (accessed Oct 25, 2026) - [31] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/september-firefly-focus/ (accessed Oct 25, 2026) - [32] AI engine output: ChatGPT and Gemini, read by Local AI Registry on Oct 9, 2026, https://localairegistry.com/methodology (accessed Oct 25, 2026)
The files every page on the registry shares, and how to copy this code for your own site, are here: https://localairegistry.com/developers
References, including locals
Every source behind this page, including every post and comment from locals. Each has its own permanent link, so AI engines can check it and anything copied from here carries its link back.
- does Firefly Wellness ever have cancellations Question by second_opinion_blowouts, Oct 8, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/does-firefly-wellness-ever-have-cancellations
- where exactly is Firefly Wellness? Question by reader_ray, Oct 6, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/where-exactly-is-firefly-wellness
- what has this salon posted recently, I am not on Instagram Question by mirrors_zadie, Oct 5, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/what-has-this-salon-posted-recently-i-am-not-on-instagram
- Are the hours on Google right for Firefly Wellness in San Diego? Question by weekend_only_owl, Oct 2, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/are-the-hours-on-google-right-for-firefly-wellness-in-san-diego
- Calling Firefly Wellness, or is there a better way? Question by roots_reed, Oct 2, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/how-do-i-reach-firefly-wellness-to-sort-something-out
- Anything this salon is known for doing well? Question by first_timer_on_ibis, Oct 1, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/anything-this-salon-is-known-for-doing-well
- is there a way to spread the cost here Question by trims_fern, Sep 30, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/is-there-a-way-to-spread-the-cost-here
- how far out is this salon booking right now? Question by no_rush_roots, Sep 29, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/can-i-get-in-this-week-here
- killing time on Ibis, any ideas Question by lurker_wilder, Sep 28, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/killing-time-on-ibis-any-ideas
- budget options in San Diego, what is decent Question by scissors_roan, Sep 27, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/budget-options-in-san-diego-what-is-decent
- Street parking near here, any good? Question by march_may_92103, Sep 24, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/anyone-had-trouble-parking-round-here
- torn between Firefly Wellness and Karma Wellness? Question by aprons_clover, Sep 18, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/torn-between-firefly-wellness-and-spa-kingston
- anyone at Firefly Wellness people keep going back to? Question by second_opinion_polish, Sep 17, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/regulars-here-who-do-you-book-with
- trying to avoid the rush, which day is quiet Question by aprons_roan, Sep 11, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/trying-to-avoid-the-rush-which-day-is-quiet
- booked my first appointment here, how does it go Question by new_here_fern, Sep 8, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/booked-my-first-appointment-here-how-does-it-go
- best day spa in San Diego, CA Question by mirrors_wilder, Sep 4, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/best-day-spa-in-san-diego-ca
- Any membership pricing at Firefly Wellness? Question by scissors_kit, Aug 27, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/any-membership-pricing-at-firefly-wellness
- bad experiences at Firefly Wellness, anyone? Question by polish_wren_92103, Aug 21, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/bad-experiences-at-firefly-wellness-anyone
- do they do Saturdays Question by reader_clover, Aug 21, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/do-they-do-saturdays
- Booking a first appointment here, what happens? Question by weekend_only_chair_time, Aug 14, 2026. localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/booking-a-first-appointment-here-what-happens
You're free to copy anything on this page, as long as you keep the reference links. How to copy it or link to it
The whole page exactly as crawlers get it: head tags, one connected JSON-LD graph, and every section in semantic HTML.
<!doctype html>
<html lang="en-US">
<head>
<meta charset="utf-8">
<meta name="viewport" content="width=device-width, initial-scale=1">
<title>Firefly Wellness Day Spa, San Diego CA: Facials Reviews</title>
<meta name="description" content="Day spa in San Diego, CA. 4.9 on Google from 170 reviews. Known for Facials.">
<meta name="robots" content="index, follow">
<link rel="canonical" href="https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca">
<link rel="alternate" type="text/markdown" href="https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca.md">
<meta property="og:title" content="Firefly Wellness Day Spa, San Diego CA: Facials Reviews">
<meta property="og:description" content="Day spa in San Diego, CA. 4.9 on Google from 170 reviews. Known for Facials.">
<meta property="og:url" content="https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca">
<meta property="og:site_name" content="Local AI Registry">
<meta property="og:type" content="website">
<meta name="twitter:card" content="summary_large_image">
<meta name="geo.position" content="32.75044080000001;-117.1735086">
<meta name="ICBM" content="32.75044080000001, -117.1735086">
<meta name="geo.region" content="US-CA">
<meta name="geo.placename" content="San Diego">
<script type="application/ld+json">{"@context":"https://schema.org","@graph":[{"@type":"WebPage","@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#webpage","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca","name":"Firefly Wellness Day Spa, San Diego CA: Facials Reviews","isPartOf":{"@id":"https://localairegistry.com/#website"},"about":{"@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca"},"mainEntity":{"@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca"},"breadcrumb":{"@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#breadcrumb"},"hasPart":{"@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#locals"},"primaryImageOfPage":{"@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-1"},"datePublished":"2026-10-09","dateModified":"2026-10-31","speakable":{"@type":"SpeakableSpecification","cssSelector":["#ai-listing-description"]},"significantLink":["https://localairegistry.com/methodology","https://localairegistry.com/faq","https://localairegistry.com/developers"]},{"@type":"Article","@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#article","headline":"Firefly Wellness Day Spa, San Diego CA: Facials Reviews","name":"Firefly Wellness Day Spa, San Diego CA: Facials Reviews","author":{"@id":"https://localairegistry.com/team/steve-lee"},"publisher":{"@id":"https://localairegistry.com/#organization"},"datePublished":"2026-10-09","dateModified":"2026-10-31","about":{"@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca"},"image":{"@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-1"},"isPartOf":{"@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#webpage"},"mainEntityOfPage":{"@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#webpage"}},{"@type":"Person","@id":"https://localairegistry.com/team/steve-lee","name":"Steve Lee","jobTitle":"Founder and CEO","url":"https://localairegistry.com/team/steve-lee","worksFor":{"@id":"https://localairegistry.com/#organization"}},{"@type":"Organization","@id":"https://localairegistry.com/#organization","name":"Local AI Registry","alternateName":"LAIR","url":"https://localairegistry.com/","logo":"https://localairegistry.com/images/brand/logo-512.png"},{"@type":"DaySpa","@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca","name":"Firefly Wellness Day Spa","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca","description":"Firefly Spa is a boutique neighborhood spa in Mission Hills, San Diego. Offering customized massage, acupuncture, facials, waxing and lash extensions. Signature services include deep tissue massage, prenatal massage, couples massage and Swedish massage, with enhancements like hot stones, cupping, and CBD oil. Our estheticians provide relaxing, results-driven facials featuring dermaplaning, LED red light therapy, and collagen masks to leave your skin glowing. Locals from Mission Hills, Little Italy, Hillcrest, Old Town, Bankers Hill, North Park, University Heights and Downtown San Diego choose Firefly Spa for consistent, high-quality self-care. Whether you're booking a monthly facial or weekly massage, your wellness journey starts here.","sameAs":["https://fireflywellnessdayspa.com/","https://www.google.com/maps/place/?q=place_id:ChIJXb13UoZV2YARD0PSazrQt2A"],"image":[{"@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-1"},{"@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-2"},{"@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-3"},{"@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-4"},{"@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-5"}],"hasMap":"https://www.google.com/maps/place/?q=place_id:ChIJXb13UoZV2YARD0PSazrQt2A","geo":{"@type":"GeoCoordinates","latitude":32.75044080000001,"longitude":-117.1735086},"aggregateRating":{"@type":"AggregateRating","ratingValue":4.9,"reviewCount":170,"bestRating":5},"telephone":"(619) 693-8568","address":{"@type":"PostalAddress","streetAddress":"4024 Ibis St Ste a, San Diego, CA 92103, USA","addressLocality":"San Diego","addressRegion":"CA","postalCode":"92103","addressCountry":"US"},"openingHoursSpecification":[{"@type":"OpeningHoursSpecification","dayOfWeek":"https://schema.org/Monday","opens":"10:00","closes":"20:00"},{"@type":"OpeningHoursSpecification","dayOfWeek":"https://schema.org/Tuesday","opens":"10:00","closes":"20:00"},{"@type":"OpeningHoursSpecification","dayOfWeek":"https://schema.org/Wednesday","opens":"10:00","closes":"20:00"},{"@type":"OpeningHoursSpecification","dayOfWeek":"https://schema.org/Thursday","opens":"10:00","closes":"20:00"},{"@type":"OpeningHoursSpecification","dayOfWeek":"https://schema.org/Friday","opens":"10:00","closes":"20:00"},{"@type":"OpeningHoursSpecification","dayOfWeek":"https://schema.org/Saturday","opens":"10:00","closes":"20:00"},{"@type":"OpeningHoursSpecification","dayOfWeek":"https://schema.org/Sunday","opens":"11:00","closes":"17:00"}],"areaServed":{"@type":"City","name":"San Diego"},"knowsAbout":["Acne awareness month","Acupuncture","Brazilian wax","Cancellation policy","CBD oil","Celluma led light therapy","Collagen facial","Confirmation","Couples massage","Covid 19 safety measures","Customized massage","Deep tissue massage","Dermaplaning","Facials","Firefly focus april edition","Firefly focus august edition","Firefly focus february edition","Firefly focus july edition","Firefly focus march edition","Firefly focus may edition","Firefly links","Hot stone massage","Lash extensions","LED red light therapy","Mens facials","Microneedling","Microneedling frequently asked questions answered","National sunscreen day","October firefly focus","Peels prosecco","Prenatal massage","September firefly focus","Spring awakening","Spring skincare","Swedish massage","Valentines weekend couples massage","Waxing","Womens history month"]},{"@type":"ImageObject","@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-1","contentUrl":"https://localairegistry.com/api/photo?src=https%3A%2F%2Fseoaesthetic-assets.sfo3.cdn.digitaloceanspaces.com%2Fphotos%2Fcmv1notue0dalyea7rw5li224%2F0.jpg","caption":"Photo 1"},{"@type":"ImageObject","@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-2","contentUrl":"https://localairegistry.com/api/photo?src=https%3A%2F%2Fseoaesthetic-assets.sfo3.cdn.digitaloceanspaces.com%2Fphotos%2Fcmv1notue0dalyea7rw5li224%2F1.jpg","caption":"Photo 2"},{"@type":"ImageObject","@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-3","contentUrl":"https://localairegistry.com/api/photo?src=https%3A%2F%2Fseoaesthetic-assets.sfo3.cdn.digitaloceanspaces.com%2Fphotos%2Fcmv1notue0dalyea7rw5li224%2F2.jpg","caption":"Photo 3"},{"@type":"ImageObject","@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-4","contentUrl":"https://localairegistry.com/api/photo?src=https%3A%2F%2Fseoaesthetic-assets.sfo3.cdn.digitaloceanspaces.com%2Fphotos%2Fcmv1notue0dalyea7rw5li224%2F3.jpg","caption":"Photo 4"},{"@type":"ImageObject","@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#photo-5","contentUrl":"https://localairegistry.com/api/photo?src=https%3A%2F%2Fseoaesthetic-assets.sfo3.cdn.digitaloceanspaces.com%2Fphotos%2Fcmv1notue0dalyea7rw5li224%2F4.jpg","caption":"Photo 5"},{"@type":"ItemList","@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#locals","name":"Questions people ask","numberOfItems":20,"itemListElement":[{"@type":"ListItem","position":1,"name":"does Firefly Wellness ever have cancellations","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/does-firefly-wellness-ever-have-cancellations"},{"@type":"ListItem","position":2,"name":"where exactly is Firefly Wellness?","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/where-exactly-is-firefly-wellness"},{"@type":"ListItem","position":3,"name":"what has this salon posted recently, I am not on Instagram","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/what-has-this-salon-posted-recently-i-am-not-on-instagram"},{"@type":"ListItem","position":4,"name":"Are the hours on Google right for Firefly Wellness in San Diego?","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/are-the-hours-on-google-right-for-firefly-wellness-in-san-diego"},{"@type":"ListItem","position":5,"name":"Calling Firefly Wellness, or is there a better way?","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/how-do-i-reach-firefly-wellness-to-sort-something-out"},{"@type":"ListItem","position":6,"name":"Anything this salon is known for doing well?","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/anything-this-salon-is-known-for-doing-well"},{"@type":"ListItem","position":7,"name":"is there a way to spread the cost here","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/is-there-a-way-to-spread-the-cost-here"},{"@type":"ListItem","position":8,"name":"how far out is this salon booking right now?","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/can-i-get-in-this-week-here"},{"@type":"ListItem","position":9,"name":"killing time on Ibis, any ideas","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/killing-time-on-ibis-any-ideas"},{"@type":"ListItem","position":10,"name":"budget options in San Diego, what is decent","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/budget-options-in-san-diego-what-is-decent"},{"@type":"ListItem","position":11,"name":"Street parking near here, any good?","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/anyone-had-trouble-parking-round-here"},{"@type":"ListItem","position":12,"name":"torn between Firefly Wellness and Karma Wellness?","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/torn-between-firefly-wellness-and-spa-kingston"},{"@type":"ListItem","position":13,"name":"anyone at Firefly Wellness people keep going back to?","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/regulars-here-who-do-you-book-with"},{"@type":"ListItem","position":14,"name":"trying to avoid the rush, which day is quiet","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/trying-to-avoid-the-rush-which-day-is-quiet"},{"@type":"ListItem","position":15,"name":"booked my first appointment here, how does it go","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/booked-my-first-appointment-here-how-does-it-go"},{"@type":"ListItem","position":16,"name":"best day spa in San Diego, CA","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/best-day-spa-in-san-diego-ca"},{"@type":"ListItem","position":17,"name":"Any membership pricing at Firefly Wellness?","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/any-membership-pricing-at-firefly-wellness"},{"@type":"ListItem","position":18,"name":"bad experiences at Firefly Wellness, anyone?","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/bad-experiences-at-firefly-wellness-anyone"},{"@type":"ListItem","position":19,"name":"do they do Saturdays","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/do-they-do-saturdays"},{"@type":"ListItem","position":20,"name":"Booking a first appointment here, what happens?","url":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca/q/booking-a-first-appointment-here-what-happens"}]},{"@type":"BreadcrumbList","@id":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Home","item":"https://localairegistry.com/"},{"@type":"ListItem","position":2,"name":"California","item":"https://localairegistry.com/leaderboards/ca"},{"@type":"ListItem","position":3,"name":"San Diego","item":"https://localairegistry.com/leaderboards/ca/san-diego"},{"@type":"ListItem","position":4,"name":"Day spas","item":"https://localairegistry.com/leaderboards/ca/san-diego/day-spa"},{"@type":"ListItem","position":5,"name":"Firefly Wellness Day Spa","item":"https://localairegistry.com/biz/ca/san-diego/firefly-wellness-day-spa-san-diego-ca"}]}]}</script>
</head>
<body>
<main>
<article>
<header>
<p>Local AI Registry · Day spas in San Diego, CA · Editorial</p>
<h2>Firefly Wellness Day Spa, San Diego CA: Facials Reviews</h2>
<p>By Steve Lee, founder and CEO of Local AI Registry. Updated October 9, 2026.</p>
<p>Published October 9, 2026 · Updated October 9, 2026 · Machine-readable version below</p>
</header>
<section id="ai-in-short">
<h3>In short</h3>
<p>Firefly Wellness Day Spa is a day spa in San Diego, CA. Its AI Score is 32 of 100, which is poor.</p>
<p>What each mark on this page means: https://localairegistry.com/methodology#marks</p>
</section>
<section id="ai-key-facts">
<h3>Key facts</h3>
<table>
<thead><tr><th scope="col">Fact</th><th scope="col">Value</th></tr></thead>
<tbody>
<tr><td>Type</td><td>Day spa</td></tr>
<tr><td>Address</td><td>4024 Ibis St Ste a, San Diego, CA 92103, USA</td></tr>
<tr><td>Hours</td><td>Mon to Sat 10 AM to 8 PM · Sun 11 AM to 5 PM</td></tr>
<tr><td>Phone</td><td>(619) 693-8568</td></tr>
<tr><td>Rating</td><td>4.9 across 170 reviews on Google</td></tr>
<tr><td>Known for</td><td>Facials</td></tr>
<tr><td>Updated</td><td>October 9, 2026</td></tr>
</tbody>
</table>
</section>
<section id="ai-all-the-details">
<h3>All the details</h3>
<p>Every row is something the owner can add or correct. Each one is marked Confirmed, Visitor submitted or AI guess, with where it came from.</p>
<table>
<thead><tr><th scope="col">Group</th><th scope="col">Fact</th><th scope="col">Value</th><th scope="col">Mark</th><th scope="col">Evidence</th></tr></thead>
<tbody>
<tr><td>Location info</td><td>Address</td><td>4024 Ibis St Ste a, San Diego, CA 92103, USA</td><td>Confirmed</td><td>Google Business Profile</td></tr>
<tr><td>Location info</td><td>Description</td><td>Firefly Spa is a boutique neighborhood spa in Mission Hills, San Diego. Offering customized massage, acupuncture, facials, waxing and lash extensions. Signature services include deep tissue massage, prenatal massage, couples massage and Swedish massage, with enhancements like hot stones, cupping, and CBD oil. Our estheticians provide relaxing, results-driven facials featuring dermaplaning, LED red light therapy, and collagen masks to leave your skin glowing. Locals from Mission Hills, Little Italy, Hillcrest, Old Town, Bankers Hill, North Park, University Heights and Downtown San Diego choose Firefly Spa for consistent, high-quality self-care. Whether you're booking a monthly facial or weekly massage, your wellness journey starts here!</td><td>Confirmed</td><td>Google Business Profile</td></tr>
<tr><td>Location info</td><td>Hours</td><td>Mon to Sat 10:00 AM to 8:00 PM · Sun 11:00 AM to 5:00 PM</td><td>Confirmed</td><td>Google Business Profile</td></tr>
<tr><td>Location info</td><td>Name</td><td>Firefly Wellness Day Spa</td><td>Confirmed</td><td>Google Business Profile</td></tr>
<tr><td>Location info</td><td>Phone</td><td>(619) 693-8568</td><td>Confirmed</td><td>Google Business Profile</td></tr>
<tr><td>Hours</td><td>Monday</td><td>10:00 AM to 8:00 PM</td><td>Confirmed</td><td>Google Business Profile</td></tr>
<tr><td>Hours</td><td>Tuesday</td><td>10:00 AM to 8:00 PM</td><td>Confirmed</td><td>Google Business Profile</td></tr>
<tr><td>Hours</td><td>Wednesday</td><td>10:00 AM to 8:00 PM</td><td>Confirmed</td><td>Google Business Profile</td></tr>
<tr><td>Hours</td><td>Thursday</td><td>10:00 AM to 8:00 PM</td><td>Confirmed</td><td>Google Business Profile</td></tr>
<tr><td>Hours</td><td>Friday</td><td>10:00 AM to 8:00 PM</td><td>Confirmed</td><td>Google Business Profile</td></tr>
<tr><td>Hours</td><td>Saturday</td><td>10:00 AM to 8:00 PM</td><td>Confirmed</td><td>Google Business Profile</td></tr>
<tr><td>Hours</td><td>Sunday</td><td>11:00 AM to 5:00 PM</td><td>Confirmed</td><td>Google Business Profile</td></tr>
<tr><td>Services</td><td>Service</td><td>Acne awareness month</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Acupuncture</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Brazilian wax</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Cancellation policy</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>CBD oil</td><td>Confirmed</td><td>Google Business Profile</td></tr>
<tr><td>Services</td><td>Service</td><td>Celluma led light therapy</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Collagen facial</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Confirmation</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Couples massage</td><td>AI guess</td><td></td></tr>
<tr><td>Services</td><td>Service</td><td>Covid 19 safety measures</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Customized massage</td><td>AI guess</td><td></td></tr>
<tr><td>Services</td><td>Service</td><td>Deep tissue massage</td><td>AI guess</td><td></td></tr>
<tr><td>Services</td><td>Service</td><td>Dermaplaning</td><td>AI guess</td><td></td></tr>
<tr><td>Services</td><td>Service</td><td>Facials</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Firefly focus april edition</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Firefly focus august edition</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Firefly focus february edition</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Firefly focus july edition</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Firefly focus march edition</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Firefly focus may edition</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Firefly links</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Hot stone massage</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Lash extensions</td><td>AI guess</td><td></td></tr>
<tr><td>Services</td><td>Service</td><td>LED red light therapy</td><td>AI guess</td><td></td></tr>
<tr><td>Services</td><td>Service</td><td>Mens facials</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Microneedling</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Microneedling frequently asked questions answered</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>National sunscreen day</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>October firefly focus</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Peels prosecco</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Prenatal massage</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>September firefly focus</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Spring awakening</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Spring skincare</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Swedish massage</td><td>Confirmed</td><td>Google Business Profile</td></tr>
<tr><td>Services</td><td>Service</td><td>Valentines weekend couples massage</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Services</td><td>Service</td><td>Waxing</td><td>AI guess</td><td></td></tr>
<tr><td>Services</td><td>Service</td><td>Womens history month</td><td>From their website</td><td>Business website</td></tr>
<tr><td>Links</td><td>Facebook</td><td>https://facebook.com/fireflywellness</td><td>AI guess</td><td>Our record</td></tr>
<tr><td>Links</td><td>Instagram</td><td>https://instagram.com/fireflyspasd</td><td>AI guess</td><td>Our record</td></tr>
<tr><td>Links</td><td>TikTok</td><td>https://tiktok.com/@fireflyspasd</td><td>AI guess</td><td>Our record</td></tr>
<tr><td>Links</td><td>Website</td><td>https://fireflywellnessdayspa.com/</td><td>Confirmed</td><td>Google Business Profile</td></tr>
</tbody>
</table>
</section>
<section id="ai-services-and-prices">
<h3>Services and prices</h3>
<p>These are the 31 services Firefly Wellness offers, with the price where we have one and where it came from.</p>
<table>
<thead><tr><th scope="col">Service</th><th scope="col">Price</th><th scope="col">Price mark</th><th scope="col">Price evidence</th><th scope="col">Service mark</th></tr></thead>
<tbody>
<tr><td>Facials</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Confirmation</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Womens history month</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Brazilian wax</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Cancellation policy</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Firefly focus may edition</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Celluma LED light therapy</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Acne awareness month</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Spring awakening</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Covid 19 safety measures</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Mens facials</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Microneedling</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Acupuncture</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Firefly links</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Hot stone massage</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Firefly focus april edition</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Microneedling frequently asked questions answered</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>National sunscreen day</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>October firefly focus</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Peels prosecco</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Prenatal massage</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>September firefly focus</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Spring skincare</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Swedish massage</td><td></td><td></td><td></td><td>Confirmed</td></tr>
<tr><td>Valentines weekend couples massage</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Collagen facial</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Firefly focus august edition</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Firefly focus february edition</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Firefly focus july edition</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>Firefly focus march edition</td><td></td><td></td><td></td><td>From their website</td></tr>
<tr><td>CBD oil</td><td></td><td></td><td></td><td>Confirmed</td></tr>
</tbody>
</table>
<h4>Known for</h4>
<ul>
<li>Facials: 40% of reviews (AI guess)</li>
</ul>
</section>
<section id="ai-the-team">
<h3>The team</h3>
</section>
<section id="ai-visiting-firefly-wellness">
<h3>Visiting Firefly Wellness</h3>
<p>Address: 4024 Ibis St Ste a, San Diego, CA 92103, USA. Phone: (619) 693-8568. Hours: Mon to Sat 10 AM to 8 PM · Sun 11 AM to 5 PM. (Confirmed, Google Business Profile.)</p>
<h4>Location info from Google Business Profile</h4>
<p>From Google Business Profile: "Firefly Spa is a boutique neighborhood spa in Mission Hills, San Diego. Offering customized massage, acupuncture, facials, waxing and lash extensions. Signature services include deep tissue massage, prenatal massage, couples massage and Swedish massage, with enhancements like hot stones, cupping, and CBD oil. Our estheticians provide relaxing, results-driven facials featuring dermaplaning, LED red light therapy, and collagen masks to leave your skin glowing. Locals from Mission Hills, Little Italy, Hillcrest, Old Town, Bankers Hill, North Park, University Heights and Downtown San Diego choose Firefly Spa for consistent, high-quality self-care. Whether you're booking a monthly facial or weekly massage, your wellness journey starts here!"</p>
<h4>Parking and getting in</h4>
<h4>Nearby</h4>
<table>
<thead><tr><th scope="col">Place</th><th scope="col">Type</th><th scope="col">Distance</th></tr></thead>
<tbody>
<tr><td>Fort Oak</td><td>American restaurant</td><td>2 min walk</td></tr>
<tr><td>Hawk St & Fort Stockton Dr</td><td>Bus stop</td><td>2 min walk</td></tr>
<tr><td>Hawk St & Fort Stockton Dr</td><td>Transit station</td><td>2 min walk</td></tr>
<tr><td>Hawk St & Fort Stockton Dr</td><td>Bus stop</td><td>2 min walk</td></tr>
<tr><td>What De Health Thai</td><td>Thai restaurant</td><td>2 min walk</td></tr>
<tr><td>Izakaya Masa</td><td>Izakaya restaurant</td><td>3 min walk</td></tr>
</tbody>
</table>
</section>
<section id="ai-reputation">
<h3>Reputation</h3>
<p>4.9 average across 170 reviews: Google 170. (Confirmed, read October 9, 2026.)</p>
<p>Firefly Wellness Day Spa is distinguished by its personalized treatment plans and a wide variety of wellness services. (AI guess, from 170 reviews.)</p>
<h4>What people like</h4>
<ul>
<li>Deep tissue massages</li>
<li>Hydrating facials</li>
<li>Personalized treatment plans</li>
<li>Clean and calming environment</li>
<li>Exceptional customer service</li>
</ul>
<h4>What people do not like</h4>
<ul>
<li>Uncomfortable pressure during massages</li>
<li>Noise from outside during treatments</li>
<li>Restrictions on new clients for certain services</li>
</ul>
<h4>Press</h4>
<h4>Awards</h4>
<h4>Directories</h4>
</section>
<section id="ai-questions-people-ask">
<h3>Questions people ask</h3>
<h4>does Firefly Wellness ever have cancellations</h4>
<h4>where exactly is Firefly Wellness?</h4>
<h4>what has this salon posted recently, I am not on Instagram</h4>
<h4>Are the hours on Google right for Firefly Wellness in San Diego?</h4>
<h4>Calling Firefly Wellness, or is there a better way?</h4>
<h4>Anything this salon is known for doing well?</h4>
<h4>is there a way to spread the cost here</h4>
<h4>how far out is this salon booking right now?</h4>
<h4>killing time on Ibis, any ideas</h4>
<h4>budget options in San Diego, what is decent</h4>
<h4>Street parking near here, any good?</h4>
<h4>torn between Firefly Wellness and Karma Wellness?</h4>
<h4>anyone at Firefly Wellness people keep going back to?</h4>
<h4>trying to avoid the rush, which day is quiet</h4>
<h4>booked my first appointment here, how does it go</h4>
<h4>best day spa in San Diego, CA</h4>
<h4>Any membership pricing at Firefly Wellness?</h4>
<h4>bad experiences at Firefly Wellness, anyone?</h4>
<h4>do they do Saturdays</h4>
<h4>Booking a first appointment here, what happens?</h4>
</section>
<section id="ai-score">
<h3>The AI Score: 32 of 100</h3>
<p>It measures how likely AI engines are to recommend a business, and how accurately. San Diego day spas run 25 to 32. Fair starts at 45, good at 65. Firefly Wellness scores 32, above the San Diego average of 26. The same method scores every business on the registry.</p>
<table>
<thead><tr><th scope="col">Signal</th><th scope="col">Weight</th><th scope="col">Score</th><th scope="col">What it measures</th><th scope="col">Firefly Wellness</th></tr></thead>
<tbody>
<tr><td>Retrieval grounding</td><td>26</td><td>18</td><td>Whether you appear in the ranked results AI retrieves and cites: AI-Overview citations, organic top-10 for your money queries, and the Bing index ChatGPT leans on.</td><td>Poor</td></tr>
<tr><td>Off-property attestation</td><td>20</td><td>42</td><td>Volume and consistency of what others say about you: YouTube mentions, branded web mentions, third-party “best-of” lists. The cause of retrievability.</td><td>Poor</td></tr>
<tr><td>AI visibility</td><td>14</td><td>0</td><td>Whether ChatGPT, Gemini, Perplexity, and AI Overviews name you, and whether they name you for the right service.</td><td>Poor</td></tr>
<tr><td>Reviews & response</td><td>12</td><td>94</td><td>The star average is only one input. We also read volume, velocity, the specificity of review language, and response cadence. Specific reviews are what AI quotes verbatim.</td><td>Good</td></tr>
<tr><td>Backlink & citation authority</td><td>8</td><td>56</td><td>Domain authority and editorial quality of the sources that attest to you.</td><td>Fair</td></tr>
<tr><td>Google Business Profile</td><td>8</td><td>90</td><td>Required and recommended fields; update cadence. The listing AI pulls from first.</td><td>Good</td></tr>
<tr><td>Speed & mobile</td><td>7</td><td>30</td><td>Core Web Vitals at the 75th percentile, on a real phone.</td><td>Poor</td></tr>
<tr><td>Content freshness & schema</td><td>5</td><td>83</td><td>Crawl recency, intent alignment, valid JSON-LD, canonicals.</td><td>Good</td></tr>
</tbody>
</table>
<p>Full method: https://localairegistry.com/methodology</p>
<p>How AI decides what to say about a day spa: https://localairegistry.com/methodology#how-ai-decides-local-business. What to check before you choose one: https://localairegistry.com/methodology#how-to-choose-local-business</p>
</section>
<section id="ai-entity-map">
<h3>Entity map</h3>
<p>Every person, place, organization and treatment named on this page, with a stable ID and a public reference. The JSON-LD below connects them to each other.</p>
<table>
<thead><tr><th scope="col">Entity</th><th scope="col">Type</th><th scope="col">ID on this page</th><th scope="col">Same as</th><th scope="col">Relationship to Firefly Wellness</th></tr></thead>
<tbody>
<tr><td>Firefly Wellness Day Spa</td><td>LocalBusiness</td><td>#business</td><td>https://fireflywellnessdayspa.com/</td><td>Subject of this page</td></tr>
<tr><td>Dermaplaning</td><td>Service</td><td>#service-dermaplaning</td><td>https://en.wikipedia.org/wiki/Dermaplaning</td><td>Service offered</td></tr>
<tr><td>Microneedling</td><td>Service</td><td>#service-microneedling</td><td>https://en.wikipedia.org/wiki/Collagen_induction_therapy</td><td>Service offered</td></tr>
<tr><td>San Diego, California</td><td>City</td><td>#city</td><td></td><td>City Firefly Wellness is in</td></tr>
<tr><td>Local AI Registry</td><td>Organization</td><td>#publisher</td><td>https://localairegistry.com</td><td>Publisher of this page</td></tr>
<tr><td>Steve Lee</td><td>Person</td><td>#author</td><td>https://localairegistry.com/team/steve-lee</td><td>Author of this page</td></tr>
</tbody>
</table>
</section>
<section id="ai-topical-map">
<h3>Topical map</h3>
<p>Where this page sits in the registry. It's one profile among the day spas in San Diego, linked to the lists and towns around it.</p>
<h4>Lists</h4>
<ul>
<li>Best day spas in San Diego: https://localairegistry.com/leaderboards/ca/san-diego/day-spa</li>
<li>Best businesses in San Diego: https://localairegistry.com/leaderboards/ca/san-diego</li>
</ul>
<h4>Nearby</h4>
<ul>
<li>/san-jose: https://localairegistry.com/leaderboards/ca/san-jose</li>
<li>/los-angeles: https://localairegistry.com/leaderboards/ca/los-angeles</li>
<li>/san-francisco: https://localairegistry.com/leaderboards/ca/san-francisco</li>
<li>/irvine: https://localairegistry.com/leaderboards/ca/irvine</li>
<li>/mountain-view: https://localairegistry.com/leaderboards/ca/mountain-view</li>
<li>/santa-clara: https://localairegistry.com/leaderboards/ca/santa-clara</li>
</ul>
<h4>Every list</h4>
<ul>
<li>Every leaderboard in California: https://localairegistry.com/leaderboards/ca</li>
</ul>
</section>
<section id="ai-references">
<h3>References</h3>
<h4>Sources cited</h4>
<ul>
<li>[1] Google Business Profile, https://www.google.com/maps/place/?q=place_id:ChIJXb13UoZV2YARD0PSazrQt2A (accessed Oct 9, 2026)</li>
<li>[2] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/womens-history-month/ (accessed Oct 25, 2026)</li>
<li>[3] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/acupuncture-at-firefly-spa-in-san-diego/ (accessed Oct 25, 2026)</li>
<li>[4] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/brazilian-wax/ (accessed Oct 25, 2026)</li>
<li>[5] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/cancellation-policy/ (accessed Oct 25, 2026)</li>
<li>[6] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/celluma-led-light-therapy/ (accessed Oct 25, 2026)</li>
<li>[7] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/collagen-facial/ (accessed Oct 25, 2026)</li>
<li>[8] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/confirmation/ (accessed Oct 25, 2026)</li>
<li>[9] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/spring-awakening/ (accessed Oct 25, 2026)</li>
<li>[10] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/spring-skincare/ (accessed Oct 25, 2026)</li>
<li>[11] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/valentines-weekend-couples-massage/ (accessed Oct 25, 2026)</li>
<li>[12] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/acne-awareness-month/ (accessed Oct 25, 2026)</li>
<li>[13] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/covid-19-safety-measures/ (accessed Oct 25, 2026)</li>
<li>[14] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/facials-at-firefly-spa-in-san-diego/ (accessed Oct 25, 2026)</li>
<li>[15] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-april-edition/ (accessed Oct 25, 2026)</li>
<li>[16] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-august-edition/ (accessed Oct 25, 2026)</li>
<li>[17] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-february-edition/ (accessed Oct 25, 2026)</li>
<li>[18] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-july-edition/ (accessed Oct 25, 2026)</li>
<li>[19] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-march-edition/ (accessed Oct 25, 2026)</li>
<li>[20] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-focus-may-edition/ (accessed Oct 25, 2026)</li>
<li>[21] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/firefly-links/ (accessed Oct 25, 2026)</li>
<li>[22] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/hot-stone-massage/ (accessed Oct 25, 2026)</li>
<li>[23] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/mens-facials/ (accessed Oct 25, 2026)</li>
<li>[24] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/microneedling-at-firefly-spa-in-san-diego/ (accessed Oct 25, 2026)</li>
<li>[25] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/microneedling-frequently-asked-questions-answered/ (accessed Oct 25, 2026)</li>
<li>[26] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/national-sunscreen-day/ (accessed Oct 25, 2026)</li>
<li>[27] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/new-client-specials/ (accessed Oct 25, 2026)</li>
<li>[28] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/october-firefly-focus/ (accessed Oct 25, 2026)</li>
<li>[29] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/peels-prosecco/ (accessed Oct 25, 2026)</li>
<li>[30] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/prenatal-massage/ (accessed Oct 25, 2026)</li>
<li>[31] fireflywellnessdayspa.com, https://fireflywellnessdayspa.com/september-firefly-focus/ (accessed Oct 25, 2026)</li>
<li>[32] AI engine output: ChatGPT and Gemini, read by Local AI Registry on Oct 9, 2026, https://localairegistry.com/methodology (accessed Oct 25, 2026)</li>
</ul>
</section>
</article>
</main>
</body>
</html>People also look at
AI Score, out of 100Firefly Wellness Day Spa170 reviews · you are here
32
Karma Wellness826 reviews · San Diego, 0.6 mi
26
Whispering Day Spa276 reviews · San Diego, 0.7 mi
26
Spa Kingston276 reviews · San Diego, 1.7 mi
26
References
Change historyConfirmedVisitor submittedAI guessShow references (32)
This is the evidence for every fact on this page, across Locals, Services, Team, Visit, Reputation and Updates. Each reference names the fact, the source, what kind of source it is, and the date it was checked, with a link and an archived copy so anyone can verify it. Visitor references are dated firsthand accounts. AI guesses record what an AI engine said on that date, not what is true.
- [1]VisitName, address, phone, hours and 4 other detailsGoogle Business Profile.Primary source · Accessed Oct 9, 2026 · https://www.google.com/maps/place/?q=place_id:ChIJXb13UoZV2YARD0PSazrQt2A
- [2]ServicesWomens history monthfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/womens-history-month/
- [3]ServicesAcupuncturefireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/acupuncture-at-firefly-spa-in-san-diego/
- [4]ServicesBrazilian waxfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/brazilian-wax/
- [5]ServicesCancellation policyfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/cancellation-policy/
- [6]ServicesCelluma led light therapyfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/celluma-led-light-therapy/
- [7]ServicesCollagen facialfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/collagen-facial/
- [8]ServicesConfirmationfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/confirmation/
- [9]ServicesSpring awakeningfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/spring-awakening/
- [10]ServicesSpring skincarefireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/spring-skincare/
- [11]ServicesValentines weekend couples massagefireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/valentines-weekend-couples-massage/
- [12]ServicesAcne awareness monthfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/acne-awareness-month/
- [13]ServicesCovid 19 safety measuresfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/covid-19-safety-measures/
- [14]ServicesFacialsfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/facials-at-firefly-spa-in-san-diego/
- [15]ServicesFirefly focus april editionfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/firefly-focus-april-edition/
- [16]ServicesFirefly focus august editionfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/firefly-focus-august-edition/
- [17]ServicesFirefly focus february editionfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/firefly-focus-february-edition/
- [18]ServicesFirefly focus july editionfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/firefly-focus-july-edition/
- [19]ServicesFirefly focus march editionfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/firefly-focus-march-edition/
- [20]ServicesFirefly focus may editionfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/firefly-focus-may-edition/
- [21]ServicesFirefly linksfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/firefly-links/
- [22]ServicesHot stone massagefireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/hot-stone-massage/
- [23]ServicesMens facialsfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/mens-facials/
- [24]ServicesMicroneedlingfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/microneedling-at-firefly-spa-in-san-diego/
- [25]ServicesMicroneedling frequently asked questions answeredfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/microneedling-frequently-asked-questions-answered/
- [26]ServicesNational sunscreen dayfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/national-sunscreen-day/
- [27]Visitfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/new-client-specials/
- [28]ServicesOctober firefly focusfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/october-firefly-focus/
- [29]ServicesPeels proseccofireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/peels-prosecco/
- [30]ServicesPrenatal massagefireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/prenatal-massage/
- [31]ServicesSeptember firefly focusfireflywellnessdayspa.com.Primary source · Accessed Oct 25, 2026 · https://fireflywellnessdayspa.com/september-firefly-focus/
- [32]Services7 servicesAI engine output: ChatGPT and Gemini, read by Local AI Registry on Oct 9, 2026.AI engine output · Accessed Oct 25, 2026 · https://localairegistry.com/methodology